Searching 4 , total 309631 products,queries done in 150 ms
Sell SA240 Grade 309Cb, 309HCb, 310S, 310H stainless plate

Sell SA240 Grade 309Cb, 309HCb, 310S, 310H stainless plate Unitedsteel factory is specialized to produce stainless steel plates and our mill min thickness is 8mm for heavy stainless steel plate, Stainless Plate manufacturer, factory and mill. 1. ASME SA240 standard ...

China United Iron and Steel Limited    [Minerals & Metallurgy]   [Steel]   [2015-10-30 11:13:09 ]

Sell SA240 Grade 310Cb, 310HCb, 310MoLN, 316 stainless plate

Sell SA240 Grade 310Cb, 310HCb, 310MoLN, 316 stainless plate Unitedsteel factory is specialized to produce stainless steel plates and our mill min thickness is 8mm for heavy stainless steel plate, Stainless Plate manufacturer, factory and mill. 1. ASME SA240 standard ...

China United Iron and Steel Limited    [Minerals & Metallurgy]   [Steel]   [2015-10-30 11:10:47 ]

Sell SA240 Grade 316L, 316H, 316Ti, 316Cb stainless plate

Sell SA240 Grade 316L, 316H, 316Ti, 316Cb stainless plate Unitedsteel factory is specialized to produce stainless steel plates and our mill min thickness is 8mm for heavy stainless steel plate, Stainless Plate manufacturer, factory and mill. 1. ASME SA240 standard specification ...

China United Iron and Steel Limited    [Minerals & Metallurgy]   [Steel]   [2015-10-30 11:08:11 ]

Sell SA240 Grade 316N, 316LN, 317, 317l stainless plate

Sell SA240 Grade 316N, 316LN, 317, 317l stainless plate Unitedsteel factory is specialized to produce stainless steel plates and our mill min thickness is 8mm for heavy stainless steel plate, Stainless Plate manufacturer, factory and mill. 1. ASME SA240 standard specification ...

China United Iron and Steel Limited    [Minerals & Metallurgy]   [Steel]   [2015-10-30 11:01:51 ]

RFID 125khz Rewrite T5577 Card

Quick Details Place of Origin: Guangdong, China (Mainland) Brand Name: Green Card Model Number: T5577 RFID card Place of Origin: Guangdong China (Mainland) Brand Name: Green Card Model Number: T5577 RFID card Material: PET, PVC Size: 85.5*54mm or custom Frequency: 125 KHZ ...

Green Card (Shenzhen) Co.,Ltd    [Energy]   [Coal]   [2015-10-30 08:20:26 ]

Blank T5577 Chip Card

Specifications 125KHz RFID prinitng T5577 chip Card/ Access Control card 1.Size:85.5*54*0.84mm or as request 2.Material:PVC, 3. 125KHZ 125KHz RFID prinitng T5577 chip Card /Access Control card Product Description Place of Origin: Guangdong China (Mainland) Brand Name: Grcard ...

Green Card (Shenzhen) Co.,Ltd    [Electronic Components & Supplies]   [Active Components]   [2015-10-30 08:19:09 ]

Blank TK4100 Chip Card

Place of Origin: Guangdong, China (Mainland), Guangdong China (Mainland) Brand Name: Green Card Model Number: TK4100 card Brand Name: Green Card Tk 4100 card Model Number: Tk 4100 card Material: PVC Size:ISO standard 85.5*54*0.8 mm or on demand Feature: Glossy, matt, frosted ...

Green Card (Shenzhen) Co.,Ltd    [Food & Beverage]   [Alcoholic Beverage]   [2015-10-30 08:15:57 ]

Procaine CAS: 59-46-1 Sell Steroid E-mail: tom@chembj.com

Procaine CAS: 59-46-1 Name: Procaine CAS: 59-46-1 MF: C13H20N2O2 MW: 236.31 EINECS: 200-426-9 Standard: USP Appearance: White Crystalline Powder Usage : inhibitor of sodium channel. Local anesthetics. The toxicity effect of humble, rapid and safe. Suitable for local anesthesia, ...

HUBEI YUANCHENG SAICHUANG TECHNOLOGY CO.,LTD    [Chemicals]   [Pharmaceutical Chemicals]   [2015-10-29 19:46:21 ]

Lidocaine CAS: 137-58-6 Sell Steroid E-mail: tom@chembj.com

Lidocaine CAS: 137-58-6 Product Name: Lidocaine Synonyms: a-Diethylamino-2,6-acetoxylidide CAS: 137-58-6 MF: C14H22N2O MW: 234.34 EINECS: 205-302-8 Product Categories: Research Chemical;Alphacaine, Xylocaine, lignocaine;REGITINE;Other APIs Chemical Properties mp 66-69°C ...

HUBEI YUANCHENG SAICHUANG TECHNOLOGY CO.,LTD    [Chemicals]   [Pharmaceutical Chemicals]   [2015-10-29 19:45:24 ]

Benzocaine CAS: 94-09-7 Sell Steroid E-mail: tom@chembj.com

Benzocaine CAS: 94-09-7 Product Name: Benzocaine Synonyms: AETHOFORM;anesthesin;AKOS BBS-00003658;4-AMINOBENZOIC ACID ETHYL ESTER;LABOTEST-BB LTBB000527;H-4-ABZ-OET CAS: 94-09-7 MF: C9H11NO2 MW: 165.19 EINECS: 202-303-5 Product Categories: Aromatic Esters;C8 to C9;Carbonyl ...

HUBEI YUANCHENG SAICHUANG TECHNOLOGY CO.,LTD    [Chemicals]   [Pharmaceutical Chemicals]   [2015-10-29 19:44:38 ]

Hexarelin CAS: 140703-51-1 Sell Steroid E-mail: tom@chembj.com

Product Name: Hexarelin Synonyms: Examorelin CAS: 140703-51-1 MF: C47H58N12O6 MW: 887.04 Product Categories: Peptide;Glucagon receptor and related;Peptides;hormones;Anti-cancer and immunity storage temp. <20°C Chemical Properties Pale Yellow Solid Usage Hexarelin is a ...

HUBEI YUANCHENG SAICHUANG TECHNOLOGY CO.,LTD    [Chemicals]   [Pharmaceutical Chemicals]   [2015-10-29 19:43:31 ]

Sermorelin CAS: 86168-78-7 Sell Steroid E-mail: tom@chembj.com

Sermorelin CAS: 86168-78-7 Product Name: Sermorelin Synonyms: SERMORELIN ACETATE;YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2 CAS: 86168-78-7 MF: C149H246N44O42S MW: 3357.88 Product Categories: Amino Acid Derivatives;Peptide;GH-RHObesity Research;GH-RHPeptides for Cell Biology;Growth ...

HUBEI YUANCHENG SAICHUANG TECHNOLOGY CO.,LTD    [Chemicals]   [Pharmaceutical Chemicals]   [2015-10-29 19:42:51 ]

Vardenafil hydrochloride 224785-91-5 Sell Steroid E-mail: tom@chembj.com

Vardenafil hydrochloride CAS: 224785-91-5 Product Name: Vardenafil hydrochloride Other Nmae: levitra CAS: 224785-91-5 MF: C23H33ClN6O4S MW: 525.06 Product Categories: Intermediates and Fine Chemicals;Pharmaceuticals;Vardenafil mp 214-216°C Usage And Synthesis Chemical ...

HUBEI YUANCHENG SAICHUANG TECHNOLOGY CO.,LTD    [Chemicals]   [Pharmaceutical Chemicals]   [2015-10-29 19:41:22 ]

Stanolone CAS: 521-18-6 Sell Steroid E-mail: tom@chembj.com

Stanolone CAS: 521-18-6 Product Name: Stanolone CAS: 521-18-6 MF: C19H30O2 MW: 290.44 EINECS: 208-307-3 Product Categories: Steroids;Intermediates and Fine Chemicals;Pharmaceuticals;Steroid and Hormone;API Chemical Properties mp 178-183°C alpha 27° storage temp. Controlled ...

HUBEI YUANCHENG SAICHUANG TECHNOLOGY CO.,LTD    [Chemicals]   [Pharmaceutical Chemicals]   [2015-10-29 19:40:27 ]

Ostarine(MK-2866) CAS: 841205-47-8 Sell Steroid E-mail: tom@chembj.com

Ostarine(MK-2866) CAS: 841205-47-8 Product Name: Ostarine Synonyms: MK-2866 (GTx-024) CAS: 841205-47-8 MF: C19H14F3N3O3 MW: 389.3279696 Product Categories: Aromatics;Intermediates and Fine Chemicals;Pharmaceuticals;Hormone Drugs;SARMs(Selective androgen receptor modulator) ...

HUBEI YUANCHENG SAICHUANG TECHNOLOGY CO.,LTD    [Chemicals]   [Pharmaceutical Chemicals]   [2015-10-29 19:39:55 ]

Norethisterone CAS: 68-22-4 Sell Steroid E-mail: tom@chembj.com

Norethisterone CAS: 68-22-4 Product Name: Norethindrone CAS: 68-22-4 MF: C20H26O2 MW: 298.42 EINECS: 200-681-6 Product Categories: Active Pharmaceutical Ingredients;Acetylenes;Biochemistry;Functionalized Acetylenes;Hydroxyketosteroids;Steroids;Intermediates and Fine ...

HUBEI YUANCHENG SAICHUANG TECHNOLOGY CO.,LTD    [Chemicals]   [Pharmaceutical Chemicals]   [2015-10-29 19:39:25 ]

Nandrolone cypionate CAS: 601-63-8 Sell Steroid E-mail: tom@chembj.com

Nandrolone cypionate CAS: 601-63-8 Product Name: Nandrolone cypionate Synonyms: Nortestosterone cypionate;Nandrolone cyclopentanepropionate CAS: 601-63-8 MF: C26H38O3 MW: 398.57812 EINECS: 210-006-7 Product Categories: Steroid and Hormone Usage: pharmaceutical material, Steroid ...

HUBEI YUANCHENG SAICHUANG TECHNOLOGY CO.,LTD    [Chemicals]   [Pharmaceutical Chemicals]   [2015-10-29 19:38:52 ]

Mibolerone CAS: 3704-09-4 Sell Steroid E-mail: tom@chembj.com

Mibolerone CAS: 3704-09-4 Product Name: Mibolerone CAS: 3704-09-4 MF: C20H30O2 MW: 302.45 EINECS: 223-046-5 Product Categories: Intermediates & Fine Chemicals;Pharmaceuticals;Steroids;Steroid and Hormone Chemical Properties mp 168-171°C storage temp. Controlled Substance, ...

HUBEI YUANCHENG SAICHUANG TECHNOLOGY CO.,LTD    [Chemicals]   [Pharmaceutical Chemicals]   [2015-10-29 19:38:17 ]

Levonorgestrel CAS: 797-63-7 Sell Steroid E-mail: tom@chembj.com

Levonorgestrel CAS: 797-63-7 Product Name: Levonorgestrel CAS: 797-63-7 MF: C21H28O2 MW: 312.45 EINECS: 212-349-8 Product Categories: Steroids;Chiral Reagents;Intermediates & Fine Chemicals;Pharmaceuticals;Steroid and Hormone;MIRENA;Hormone Drugs Chemical Properties mp 206°C ...

HUBEI YUANCHENG SAICHUANG TECHNOLOGY CO.,LTD    [Chemicals]   [Pharmaceutical Chemicals]   [2015-10-29 19:37:45 ]

Formestane CAS: 566-48-3 Sell Steroid E-mail: tom@chembj.com

Formestane CAS: 566-48-3 Product Name: Formestane Synonyms: 4-HYDROXYANDROSTENEDIONE;4-OHA;CGP-32349 CAS: 566-48-3 MF: C19H26O3 MW: 302.41 Product Categories: Pharmaceutical Raw Materials;Miscellaneous Biochemicals;Inhibitors;Intermediates and Fine ...

HUBEI YUANCHENG SAICHUANG TECHNOLOGY CO.,LTD    [Chemicals]   [Pharmaceutical Chemicals]   [2015-10-29 19:37:02 ]