Searching h , total 108757 products,queries done in 14 ms
Outdoor Spa 6 person spa for sale S800

SPECIFICATIONS Dimensions (L* W * H) 2300*2300*800mm Seating Capacity 5adults Lounge Seat (s) 3 Water Capacity 1491 liters Filter Size 50sq ft. CONTRUCTION Spa Shell (USA) Lucite? Acrylic Color of Lucite Acrylic Shell Sterling silver Spa Cabinet Material PS Wood-Plastic Composite

SpaRelax Co.,Ltd      [2015-11-05 15:26:26 ]

Outdoor Spa A860

SPECIFICATIONS Dimensions (L* W * H) 2250*2380*920mm Seating Capacity 7-8 adults Lounge Seat (s) 2 Water Capacity 1605 liters Filter Size 100sq ft. CONTRUCTION Spa Shell (USA) Lucite? Acrylic Color of Lucite Acrylic Shell Sterling silver Spa Cabinet Material PS Wood-Plastic Compo

SpaRelax Co.,Ltd      [2015-11-05 15:25:59 ]

3 person hot tub A310

SPECIFICATIONS Dimensions (L* W * H) 2050*1750*800mm Seating Capacity 3 adults Lounge Seat (s) 1 Water Capacity 786 liters Filter Size 50sq ft. CONTRUCTION Spa Shell (USA) Lucite? Acrylic Color of Lucite Acrylic Shell Sterling silver Spa Cabinet Material PS Wood-Plastic Composite

SpaRelax Co.,Ltd      [2015-11-05 15:25:35 ]

2 person hot tub prices S200

SPECIFICATIONS Dimensions (L* W * H) 2000*1200*840mm Seating Capacity 2adults Lounge Seat (s) 2 Water Capacity 605 liters Filter Size 50sq ft. CONTRUCTION Spa Shell (USA) Lucite? Acrylic Color of Lucite Acrylic Shell Sterling silver Spa Cabinet Material PS Wood-Plastic Composite

SpaRelax Co.,Ltd      [2015-11-05 15:25:09 ]

two person hot tub A312

SPECIFICATIONS Dimensions (L* W * H) 2250*1100*780mm Seating Capacity 2 adults Water Capacity 350 liters Filter Size 50sq ft. CONTRUCTION Spa Shell (USA) Lucite? Acrylic Color of Lucite Acrylic Shell Sterling silver Spa Cabinet Material PS Wood-Plastic Composite Panels Frame Pres

SpaRelax Co.,Ltd      [2015-11-05 15:24:38 ]

one person hot tub S201

Dimensions (L* W * H) 1800*1200*730mm Seating Capacity 1 adults Lounge Seat (s) 1 Water Capacity 350 liters Filter Size 50sq ft. CONTRUCTION Spa Shell (USA) Lucite? Acrylic Color of Lucite Acrylic Shell Sterling silver Spa Cabinet Material PS Wood-Plastic Composite Panels Cabinet

SpaRelax Co.,Ltd      [2015-11-05 15:22:54 ]

Glue spreader

Model BS3414-I BS3427-II Spreading Speed 30m/min 0-34m/min Diameter of spreading roller 245mm 345*2 Length of spreading roller 1400mm 2700mm Diameter of squeezing roller 180mm 240mm*2 Length of squeezing roller 1300mm 2700mm Power of the machine 4KW 5.5KW(adjustable speed motor)

临沂新天力机械有限公司      [2015-11-03 14:28:23 ]

WISDOM toroidal winding machine TT-H15C

Model TT-H 15C Wire diameter 0.6 -2.5mm Coil outside diamete 50 -200mm Max coil height 95mm Complete the internal diameter. 40mm (MIN) Spindle motor 750W alternating current motor , variable frequency drive Spreading motor stepping motor Power source AC220V; 50/60HZ Produc

Wisdom winding machine (shanghai) Co.,Ltd      [2015-11-02 14:48:37 ]

High Quality Steroid Powder Stanozolol (Winstrol) For Muscle Gain

Stanozolol (Winstrol) English Synonyms winstrol l;1,10a,12a-Trimethyl-1,2,3,3a,3b,4,5,5a,6,8,10,10a,10b,11,12,12a-hexadecahydrocyclopenta[5,6]naphtho[1,2-f]indazol-1-ol;1,2,3,3a,3b,4,5,5a,6,8,10,10a,10b,11,12,12a-hexadecahydro-1,10a,12a-trimethylc;17-Methyl-2'H-5alpha-androst-2-e

Zhuhai Shuangbojie Technology Co.,Ltd      [2015-10-30 21:14:16 ]

High Quality Steroid Powder Trenbolone Acetate For Muscle Gain

Trenbolone Acetate English Synonyms 17-(acetyloxy)-(17-beta)-estra-11-trien-3-one;17-beta-acetoxy-delta-4,9,11-estratrien-3-one;17-beta-hydroxyestra-4,9,11-trien-3-oneacetate;9,11-trien-3-one,17-beta-hydroxy-estra-acetate;finaplix;ru1697;trienboloneacetate;revalor-h CAS NO. 10161

Zhuhai Shuangbojie Technology Co.,Ltd      [2015-10-30 20:45:04 ]

W8-KM512I-30PL-4H

Model W8 -KM512I-30PL-4H Printing Quality 360dpi Printing Speed Draft Mode 480X360dpi 2pass @ 120sqm/h Production Mode 480X540dpi 3pass @ 90sqm/h Quality Mode 480X720dpi 4pass @ 60sqm/h Model W8 -KM512I-30PL-8H Printing Quality 360dpi Printing Speed Draft Mode 480X360dpi 2pass @

WinJET      [2015-10-30 16:07:40 ]

4 port 24m with12dBi uhf rfid reader

HYR830 adopts Impinj R2000 module, maximum power output is 31dbm. 4 RP TNC ports, with an 12dbi circular polarized antenna, reading distance can reach 24 meters. Reading speed is 400 tags/sec. Support LBT function. Support dense reader working mode(DRM) 8 LED lights, real-time di

联云星      [2015-10-30 15:49:46 ]

Stanozolol / Winstrol

Stanozolol, Winstrol 99% Anabolic Stanozolol (CAS 10418-03-8) 99% Purity Stanozolol Coarse Winstrol Raw Powder Steroid Product Name Stanozolol Synonyms STANOZOL;STANOZOLOL;STANAZOL;winstrol l;1,10a,12a-Trimethyl-1,2,3,3a,3b,4,5,5a,6,8,10,10a,10b,11,12,12a-hexadecahydrocyclopenta[

Zhuhaishi Shuangbojie Technology Co., Ltd      [2015-10-30 14:52:00 ]

Trenbolone Acetate

Trenbolone Acetate Anabolice Steroid Hormone Trenbolone Acetate with Safe Shipping Trenbolone Acetate 99% Min Finaplix Trenbolone Acetate Product Name Revalor-H Synonyms 17-(acetyloxy)-(17-beta)-estra-11-trien-3-one;17-beta-acetoxy-delta-4,9,11-estratrien-3-one;17-beta-hydroxyest

Zhuhaishi Shuangbojie Technology Co., Ltd      [2015-10-30 14:42:27 ]

Benzocaine

Benzocaine Synonyms Aethoform;4-aminobenzoic acid ethyl ester;Labotest-bb ltbb000527;H-4-abz-oet;Ethyl 4-aminobenzoate;Ethyl p-aminobenzoate CAS 94-09-7 MF C9H11NO2 MW 165.19 EINECS 202-303-5 HS code 29224999.90 Product Categories Aromatic Esters;C8 to C9;Carbonyl Compounds;Ester

Zhuhai Shuangbojie Technology Co.,Ltd      [2015-10-30 14:35:44 ]

Oxytocin, 2mg/vial

Oxytocin, 2mg/vial CAS 50-56-6 synonyms oxytocin lyophilized; oxytocin acetate; H-Cys-Tyr-Ile-Gln-Asn-Cys-Pro-Leu-Gly-NH2 Disulfide bond; EINECS 200-048-4 MF C43H66N12O12S2 MW 1007.19 Grade Standard Medicine Grade Appearance White powder Oxytocin is a cyclic polypeptide with all

Zhuhaishi Shuangbojie Technology Co., Ltd      [2015-10-30 14:23:41 ]

Sermorelin, 2mg/vial

Sermorelin, 2mg/vial Product Name Sermorelin Synonyms SERMORELIN;SERMORELIN ACETATE;YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2;TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2;TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-AR

Zhuhaishi Shuangbojie Technology Co., Ltd      [2015-10-30 14:23:18 ]

GHRP-6, 5mg/vial, 10mg/vial

GHRP-6, 5mg/vial, 10mg/vial Product Name Growth hormone releasing peptide Synonyms sk&f110679;[D-TRP7, ALA8, D-PHE10]-ALPHA-MELANOCYTE STIMULATING HORMONE (6-11) AMIDE;[D-TRP7,ALA8,D-PHE10]-ALPHA-MELANOCYTE STIMULATING HORMONE FRAGMENT 6-11 AMIDE;(D-TRP7,ALA8,D-PHE10)-ALPHA-MSH (

Zhuhaishi Shuangbojie Technology Co., Ltd      [2015-10-30 14:22:04 ]

PT-141,Bremelanotide, 10mg/vial

PT-141,Bremelanotide, 10mg/vial Molecular Formula C50H68N14O10 Molecular Weight 1025.16 CAS NO 189691-06-3 Sequence H-D-Ala-D-2-Nal-Ala-Trp-D-Phe-Lys-NH2 1.Appearance White powder White powder 2 Solubility Soluble in water and 1% acetic acid Conforms 3 Specifical Optical Rotation

Zhuhaishi Shuangbojie Technology Co., Ltd      [2015-10-30 14:19:05 ]

Brushless alternators

The alternator has the following features 1. +- 1.0 % Voltage regulation (max.) in static conditions 2. IP 22 protection with insulation class H 3. Permissible overload of 10% for one hour in 12 hours of operation. The alternator/generators have been designed for use in a maximum

Jiangsu Farrand Alternator      [2015-10-28 14:01:41 ]