Sell SA240 Grade 304LN, 305, 309S, 309H stainless plate Unitedsteel factory is specialized to produce stainless steel plates and our mill min thickness is 8mm for heavy stainless steel plate, Stainless Plate manufacturer, factory and mill. 1. ASME SA240 standard specification ...
China United Iron and Steel Limited [Minerals & Metallurgy] [Steel] [2015-10-30 11:13:43 ]
Sell SA240 Grade 309Cb, 309HCb, 310S, 310H stainless plate Unitedsteel factory is specialized to produce stainless steel plates and our mill min thickness is 8mm for heavy stainless steel plate, Stainless Plate manufacturer, factory and mill. 1. ASME SA240 standard ...
China United Iron and Steel Limited [Minerals & Metallurgy] [Steel] [2015-10-30 11:13:09 ]
Sell SA240 Grade 310Cb, 310HCb, 310MoLN, 316 stainless plate Unitedsteel factory is specialized to produce stainless steel plates and our mill min thickness is 8mm for heavy stainless steel plate, Stainless Plate manufacturer, factory and mill. 1. ASME SA240 standard ...
China United Iron and Steel Limited [Minerals & Metallurgy] [Steel] [2015-10-30 11:10:47 ]
Sell SA240 Grade 316L, 316H, 316Ti, 316Cb stainless plate Unitedsteel factory is specialized to produce stainless steel plates and our mill min thickness is 8mm for heavy stainless steel plate, Stainless Plate manufacturer, factory and mill. 1. ASME SA240 standard specification ...
China United Iron and Steel Limited [Minerals & Metallurgy] [Steel] [2015-10-30 11:08:11 ]
With professional and productive tz2-711 6mm black on green factory, PUTY Technology is one of the leading China brother tz-711, 6mm tze tape manufacturers and suppliers. Welcome to wholesale or buy products from ...
PUTY Technology Co.,Ltd [Office] [Office & School Supplies] [2015-10-30 11:05:34 ]
Sell SA240 Grade 316N, 316LN, 317, 317l stainless plate Unitedsteel factory is specialized to produce stainless steel plates and our mill min thickness is 8mm for heavy stainless steel plate, Stainless Plate manufacturer, factory and mill. 1. ASME SA240 standard specification ...
China United Iron and Steel Limited [Minerals & Metallurgy] [Steel] [2015-10-30 11:01:51 ]
Huzhou Hengxin Label Manufacture Co.,Ltd is one of the leading China dyed woven edge fabric label manufacturers and suppliers, we have our own dyed woven edge fabric label factory. Welcome to wholesale dyed woven edge fabric label from ...
huzhou hengxin label manufacture co., ltd [Textiles] [Textiles & Leather Products] [2015-10-30 10:43:01 ]
Place of Origin: Guangdong, China (Mainland), Guangdong, China Brand Name: GRCARD, GRcard Model Number: AT5577 Model Item: AT5577 Material: PVC Dimension: 85.6*54MM Thickness: 0.76mm Frequency: 125khz Specifications RFID 125k AT5577 card smart card manufacturer ...
Green Card (Shenzhen) Co.,Ltd [Beauty & Personal Care] [Artificial Hair] [2015-10-30 08:20:03 ]
Procaine CAS: 59-46-1 Name: Procaine CAS: 59-46-1 MF: C13H20N2O2 MW: 236.31 EINECS: 200-426-9 Standard: USP Appearance: White Crystalline Powder Usage : inhibitor of sodium channel. Local anesthetics. The toxicity effect of humble, rapid and safe. Suitable for local anesthesia, ...
HUBEI YUANCHENG SAICHUANG TECHNOLOGY CO.,LTD [Chemicals] [Pharmaceutical Chemicals] [2015-10-29 19:46:21 ]
Lidocaine CAS: 137-58-6 Product Name: Lidocaine Synonyms: a-Diethylamino-2,6-acetoxylidide CAS: 137-58-6 MF: C14H22N2O MW: 234.34 EINECS: 205-302-8 Product Categories: Research Chemical;Alphacaine, Xylocaine, lignocaine;REGITINE;Other APIs Chemical Properties mp 66-69°C ...
HUBEI YUANCHENG SAICHUANG TECHNOLOGY CO.,LTD [Chemicals] [Pharmaceutical Chemicals] [2015-10-29 19:45:24 ]
Benzocaine CAS: 94-09-7 Product Name: Benzocaine Synonyms: AETHOFORM;anesthesin;AKOS BBS-00003658;4-AMINOBENZOIC ACID ETHYL ESTER;LABOTEST-BB LTBB000527;H-4-ABZ-OET CAS: 94-09-7 MF: C9H11NO2 MW: 165.19 EINECS: 202-303-5 Product Categories: Aromatic Esters;C8 to C9;Carbonyl ...
HUBEI YUANCHENG SAICHUANG TECHNOLOGY CO.,LTD [Chemicals] [Pharmaceutical Chemicals] [2015-10-29 19:44:38 ]
Product Name: Hexarelin Synonyms: Examorelin CAS: 140703-51-1 MF: C47H58N12O6 MW: 887.04 Product Categories: Peptide;Glucagon receptor and related;Peptides;hormones;Anti-cancer and immunity storage temp. ＜20°C Chemical Properties Pale Yellow Solid Usage Hexarelin is a ...
HUBEI YUANCHENG SAICHUANG TECHNOLOGY CO.,LTD [Chemicals] [Pharmaceutical Chemicals] [2015-10-29 19:43:31 ]
Sermorelin CAS: 86168-78-7 Product Name: Sermorelin Synonyms: SERMORELIN ACETATE;YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2 CAS: 86168-78-7 MF: C149H246N44O42S MW: 3357.88 Product Categories: Amino Acid Derivatives;Peptide;GH-RHObesity Research;GH-RHPeptides for Cell Biology;Growth ...
HUBEI YUANCHENG SAICHUANG TECHNOLOGY CO.,LTD [Chemicals] [Pharmaceutical Chemicals] [2015-10-29 19:42:51 ]
Vardenafil hydrochloride CAS: 224785-91-5 Product Name: Vardenafil hydrochloride Other Nmae: levitra CAS: 224785-91-5 MF: C23H33ClN6O4S MW: 525.06 Product Categories: Intermediates and Fine Chemicals;Pharmaceuticals;Vardenafil mp 214-216°C Usage And Synthesis Chemical ...
HUBEI YUANCHENG SAICHUANG TECHNOLOGY CO.,LTD [Chemicals] [Pharmaceutical Chemicals] [2015-10-29 19:41:22 ]
Stanolone CAS: 521-18-6 Product Name: Stanolone CAS: 521-18-6 MF: C19H30O2 MW: 290.44 EINECS: 208-307-3 Product Categories: Steroids;Intermediates and Fine Chemicals;Pharmaceuticals;Steroid and Hormone;API Chemical Properties mp 178-183°C alpha 27° storage temp. Controlled ...
HUBEI YUANCHENG SAICHUANG TECHNOLOGY CO.,LTD [Chemicals] [Pharmaceutical Chemicals] [2015-10-29 19:40:27 ]
Ostarine(MK-2866) CAS: 841205-47-8 Product Name: Ostarine Synonyms: MK-2866 (GTx-024) CAS: 841205-47-8 MF: C19H14F3N3O3 MW: 389.3279696 Product Categories: Aromatics;Intermediates and Fine Chemicals;Pharmaceuticals;Hormone Drugs;SARMs(Selective androgen receptor modulator) ...
HUBEI YUANCHENG SAICHUANG TECHNOLOGY CO.,LTD [Chemicals] [Pharmaceutical Chemicals] [2015-10-29 19:39:55 ]
Norethisterone CAS: 68-22-4 Product Name: Norethindrone CAS: 68-22-4 MF: C20H26O2 MW: 298.42 EINECS: 200-681-6 Product Categories: Active Pharmaceutical Ingredients;Acetylenes;Biochemistry;Functionalized Acetylenes;Hydroxyketosteroids;Steroids;Intermediates and Fine ...
HUBEI YUANCHENG SAICHUANG TECHNOLOGY CO.,LTD [Chemicals] [Pharmaceutical Chemicals] [2015-10-29 19:39:25 ]
Nandrolone cypionate CAS: 601-63-8 Product Name: Nandrolone cypionate Synonyms: Nortestosterone cypionate;Nandrolone cyclopentanepropionate CAS: 601-63-8 MF: C26H38O3 MW: 398.57812 EINECS: 210-006-7 Product Categories: Steroid and Hormone Usage: pharmaceutical material, Steroid ...
HUBEI YUANCHENG SAICHUANG TECHNOLOGY CO.,LTD [Chemicals] [Pharmaceutical Chemicals] [2015-10-29 19:38:52 ]
Mibolerone CAS: 3704-09-4 Product Name: Mibolerone CAS: 3704-09-4 MF: C20H30O2 MW: 302.45 EINECS: 223-046-5 Product Categories: Intermediates & Fine Chemicals;Pharmaceuticals;Steroids;Steroid and Hormone Chemical Properties mp 168-171°C storage temp. Controlled Substance, ...
HUBEI YUANCHENG SAICHUANG TECHNOLOGY CO.,LTD [Chemicals] [Pharmaceutical Chemicals] [2015-10-29 19:38:17 ]
Levonorgestrel CAS: 797-63-7 Product Name: Levonorgestrel CAS: 797-63-7 MF: C21H28O2 MW: 312.45 EINECS: 212-349-8 Product Categories: Steroids;Chiral Reagents;Intermediates & Fine Chemicals;Pharmaceuticals;Steroid and Hormone;MIRENA;Hormone Drugs Chemical Properties mp 206°C ...
HUBEI YUANCHENG SAICHUANG TECHNOLOGY CO.,LTD [Chemicals] [Pharmaceutical Chemicals] [2015-10-29 19:37:45 ]
