Testosterone Acetate Other name testosterone acetate--dea schedule iii; (17beta)-3-oxoandrost-4-en-17-yl acetate; 3-oxoandrost-4-en-17-yl acetate CAS NO 1045-69-8 Appearance White crystalline powder. Package 1kg/Foil bag Testosterone Acetate Other name testosterone acetate--dea s
wuhan Yuancheng saichuang Co.,Ltd [2016-12-18 17:57:19 ]
Testosterone Acetate Other name testosterone acetate--dea schedule iii; (17beta)-3-oxoandrost-4-en-17-yl acetate; 3-oxoandrost-4-en-17-yl acetate CAS NO 1045-69-8 Appearance White crystalline powder. Package 1kg/Foil bag Testosterone Acetate Other name testosterone acetate--dea s
wuhan Yuancheng saichuang Co.,Ltd [2016-12-18 17:56:06 ]
Quick Information Brand Name xingye Place of Origin China Model Number 05 Description Polyster/Cotton Gray Fabric Suppliers Introduction of polyester cotton fabric Name Polyester cotton fabric Composition Yarn count Density Weight Width Pattern T/C 40/60 20*16 120*60 245 63\'\'
Shenze Cinye Textile Co.,Ltd. [2016-12-16 17:25:35 ]
Quick Information Brand Name xingye Place of Origin China Model Number 010 Description 100%cotton Fabric Whith Flower Printed Material 100% Cotton Yarn Count 32s Density 133*75 Width 250cm Weight 390gsm Style Reactive dyes printed, twill. Name Printed fabric cotton fabric Compos
Shenze Cinye Textile Co.,Ltd. [2016-12-16 17:21:37 ]
Custom designed yoga mat good for hot yoga Product name custom designed microfiber suede Yoga Mat good for hot yoga Material Natural rubber Color Any color customize Printing Technic Printed, Woven lable/tag Customized designs are welcome. Logo OEM Sample Time 5-7 days Mass Produ
Hangzhou Fanmao Technology Co., Ltd. [2016-12-16 11:40:03 ]
Quick Details Name C/Z Keel Roll Forming Machine Condition New Type Tile Forming Machine Tile type colored steel Brand name RFM Place of origin Hebei,China Usage Roofing accessories Dimension 3.5*1.2*1.45 Weight 2.5T Raw material PPGI/GI Material thickness 0.3-0.8mm Machine frame
Hebei Feixiang Roll Forming Machinery Co.,Ltd [2016-12-14 15:31:58 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Product Name Dextromethorphan Hydrobromide Key words Dextromethorphan Hydrobromide,Dextromethorphan Hydrobromide,Dextromethorphan Hydrobromide,Dextromethorphan Hydrobromide Dextromethorphan
Guangzhou Kafen Biotech Co.,Ltd [2016-12-12 15:51:57 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Dexamethasone Another Name 9-alpha-fluoro-11-beta,17-alpha,21-trihydroxy-16-alpha-methylpregna-1,4-diene-3,20-dione; 9-alpha-fluoro-16-alpha-methylprednisolone; 9alpha-Fluoro-11beta,17alpha,
Guangzhou Kafen Biotech Co.,Ltd [2016-12-12 15:48:30 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com INCI Name Nonapeptide-1 Amino Sequence Met-Pro-D-Phe-Arg-D-Trp-Phe-Lys-Pro-Val-NH2 Functions · Prevent melanin synthesis by preventing activation of the tyrosinase. · Prevent unwanted pigm
Guangzhou Kafen Biotech Co.,Ltd [2016-12-12 15:45:12 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Product Name Deslorelin Synonyms GLP-HIS-TRP-SER-TYR-D-TRP-LEU-ARG-PRO-NHET;[D-TRP6, DES-GLY10]-LH-RH ETHYLAMIDE;DESORELIN;DESLORELIN;deslorelin acetate;DESLORELIN (HUMAN);DES-GLY10,[D-TRP6]
Guangzhou Kafen Biotech Co.,Ltd [2016-12-12 15:43:06 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Epitalon,10mg/vial Product Name Glycine, L-alanyl-L-a-glutamyl-L-a-aspartyl- Synonyms Epitalon;Epithalon;Glycine, L-alanyl-L-a-glutamyl-L-a-aspartyl-;L-alanyl-L-alpha-glutamyl-L-alpha-aspart
Guangzhou Kafen Biotech Co.,Ltd [2016-12-12 15:40:40 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Product Name Sermorelin Synonyms SERMORELIN;SERMORELIN ACETATE;YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2;TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-G
Guangzhou Kafen Biotech Co.,Ltd [2016-12-12 14:58:01 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Product Name Hexarelin Synonyms HIS-D-2-METHYL-TRP-D-PHE-LYS-NH2;HIS-D-2-ME-TRP-ALA-TRP-D-PHE-LYS-NH2;HEXARELIN;GROWTH HORMONE RELEASING HEXAPEPTIDE;Examorelin;Hexareline;L-Histidyl-2-methyl
Guangzhou Kafen Biotech Co.,Ltd [2016-12-12 14:55:45 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Quick Detail Product Name GHRP-2 Growth Hormone Releasing Peptide 2 GHRP Sequence H-D-Ala-D-2-Nal-Ala-Trp-D-Phe-Lys-NH2 Molecular formula C45H55N9O6 Molar Mass 817.9 CAS number 158861-67-7 P
Guangzhou Kafen Biotech Co.,Ltd [2016-12-12 14:36:57 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com MT-2 Product Name Melanotan II, MT- II split into vivals, MT2 supplier, Melanotan II manufacturer MT2 Another Name Melanotan II; AC-NLE-CYCLO(-BETA-ASP-HIS-D-PHE-ARG-TRP-EPSILON-LYS-NH2); Me
Guangzhou Kafen Biotech Co.,Ltd [2016-12-12 14:35:57 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Product Name PT-141 Synonyms BREMELANOTIDE;Brmelanotice;Ac-Nle-cyclo(-Asp-His-D-Phe-Arg-Trp-Lys)-OH;Bremelanotide, PT141,PT-141;BREMELANOTIDE PT141;N-Acetyl-L-norleucyl-L-alpha-aspartyl-L-hi
Guangzhou Kafen Biotech Co.,Ltd [2016-12-12 14:30:16 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Product Name 1,3-Dimethylpentylamine hydrochloride Key words 1,3-Dimethylpentylamine hydrochloride,1,3-Dimethylpentylamine hydrochloride,DMAA hcl,DMAA hcl,DMAA hcl Synonyms 4-Methyl-2-hexana
Guangzhou Kafen Biotech Co.,Ltd [2016-12-12 14:18:42 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Phenacetin Another Name 1-acetamido-4-ethoxybenzene; para-Acetophenetidide; p-acetophenetidine; p-acetophenetide; p-acetphenetidin; paracetophentidin; p-Ethoxyacetanilide; 4\'-ethoxyacetanil
Guangzhou Kafen Biotech Co.,Ltd [2016-12-12 13:34:42 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Benzocaine Another Name 4-Aminobenzoic acid ethyl ester; benzocaine methanol solution; Ethyl 4-aminobenzoate,(4-Aminobenzoic acid ethyl ester); Benzocaine; H-4-Abz-OEt; Benzocione; 4-(ethoxy
Guangzhou Kafen Biotech Co.,Ltd [2016-12-12 10:12:27 ]
Type Garden Hose Reels Place of Origin Shandong, China (Mainland) Brand Name Tianyi Model Number TianYi-2810N-1 Garden Hose Reel Type Empty Hose Reels Material Metal / Coil Standard CE Diameter 3/8\'\' Feature Adjustable, Anti-Abrasion, Anti-Corrosion, Anti-UV, Soft Use Burnishin
Shandong Tainyi Equipment&Technology Co.,Ltd [2016-12-10 14:35:06 ]
