GLP-2 (rat)

Minimum Order: 1

Packaging: N/A

Delivery: 15 Days

CAS No.

195262-56-7

Sequence

HADGSFSDEMNTILDNLATRDFINWLIQTKITD

M.W/Mr.

3796.17

Molecular Formula

C166H256N44O56S

Application

Endogenous peptide identified as an intestinal epithelium-specific growth factor; stimulates cell proliferation and inhibits apoptosis. Diverse effects on gastrointestinal function including regulation of intestinal glucose transport, food intake, and gastric acid secretion.

Storage

-20°C

Creative Peptides is specialized in the process development and the manufacturing of bioactive peptides. We are dedicated to offering custom peptide synthesis, process development, GMP manufacturing as well as catalog products for customers in industry and research area. We provide GLP-2 (rat). Endogenous peptide identified as an intestinal epithelium-specific growth factor; stimulates cell proliferation and inhibits apoptosis. Diverse effects on gastrointestinal function including regulation of intestinal glucose transport, food intake, and gastric acid secretion.More information please visit our website: https://www.creative-peptides.com/product/glp-rat-item-r0838-34640.html

Country: United States
Business Type: Manufacturer
Market:Americas,Asia,Europe,European Union,Oceania
Founded Year:2005
Address:45-16 Ramsey Road, Shirley, New York 11967
Contact:Cathy Miller

*Your name:	Enter name here eg:Ralph zhang
*Your Email:	Enter email here
*To:	Creative Peptides
*Subject:
*Message:
	Enter between 20 to 3,000 characters. English only. Characters : 0 / 3000
*Enter the secure code shown below	Reload Image

		We do inquire for you , please wait ...

Special Antigen Peptides Services

Glycopeptides Synthesis Services

Custom Peptide Synthesis

Stable Isotope Labeled Peptides

Custom GMP Peptide Synthesis Services

Rat Complement With Diluent

This product is a Complement Serum freshly prepared from Rat whole blood in cold and then frozen at -80°C to prevent degradation of complement activity. It can be used in the hemolytic plaque assays, complement fixation assays, and other lymphocytotoxicity and hemolytic ...

Creative Biolabs