CJC1295

Packaging: N/A

Delivery: 15 Days

CJC1295

Product Name: CJC1295

Synonyms: CJC1295;Y(d -A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2;L-Tyrosyl-D-alanyl-L-alpha-aspartyl-L-alanyl-L-isoleucyl-L-phenylalanyl-L-threonyl-L-glutaminyl-L-seryl-L-tyrosyl-L-arginyl-L-lysyl-L-valyl-L-leucyl-L-alanyl-L-glutaminyl-L-seryl-L-alanyl-L-arginyl-L-lysyl-L-leucyl-L-leucyl-L-glutaminyl-L-alpha-aspartyl-L-isoleucyl-L-leucyl-L-seryl-L-arginyl-N6-[3-(2,5-dihydro-2,5-dioxo-1H-pyrrol-1-yl)-1-oxopropyl]-L-lysinamide;CJC-1295 Acetate

CAS: 863288-34-0

MF: C159H258N46O45

MW: 0

EINECS:

Product Categories: Peptides

Mol File: Mol File

Our advantage:

1. Rich experience.

We specialize in this field for many years, our steroids and hormones exported to Overseas, to Europe, Africa, Asia and Americas and so on other country, and we have got very good feedback from our customers, and had Established long friendly relations of cooperation.

2. Great quality, purity and favourable.

Good quality is one of our secret success, welcome order the samples, MOQ just 10 grams.

3. Safest and fastest delivery.

We have Adequate stock, and can delivery quickly at the very day when receive the payment.

We have special way could ship 0.01 kilo to 3.5 kilo products a time. We offer melting powder into liquid service. And ship the liquid in special bottles.

4. Good after-sales service.

Tell the package update ASAP, and will try best solve when customer encountered various.

Email:sales09 at ycphar dom com

Skype:sales09_109

Telephone:86-027-50756084

Mobile:86-18872220656

Country: China (Mainland)
Business Type:
Market:
Founded Year:2001
Address:武昌中山路496号
Contact:Sadiya Sun

*Your name:	Enter name here eg:Ralph zhang
*Your Email:	Enter email here
*To:	湖北远成药业有限公司
*Subject:
*Message:
	Enter between 20 to 3,000 characters. English only. Characters : 0 / 3000
*Enter the secure code shown below	Reload Image

		We do inquire for you , please wait ...

Estradiol

Melengestrol acetate

Progesterone

Ziconotide acetate

Triptorelin

HGH HCG5000iu bpc-157 CJC1295 Epithaol selank

HGH HCG5000iu bpc-157 CJC1295 Epithaol selank Tirzepatide semaglutide retatrutide melanotan II Our company also has many kinds of products please contact me if you need my product whatsapp:+8613681550046 telegram:+8613028607230 ...

Hebei Hailang Biotechnology Co., Ltd

HGH HCG5000iu bpc-157 CJC1295 Epithaol selank

HGH HCG5000iu bpc-157 CJC1295 Epithaol selank Tirzepatide semaglutide tetatrutide melanotan II our company also has many kinds of products please contact me if you need my product whatsapp:+8613681550046 telegram:+8613028607230 ...

Hebei Hailang Biotechnology Co., Ltd

High purity CJC-1295 CAS Number 863288-34-0

Our company is a high-tech biomedical and chemical enterprise integrating research,development, production and sales. It is also a professional biotechnology service company dedicated to the country\'s major biomedical units, enterprises, universities and scientific research ...

Hebei Zhaojun New Material Technology Co., LTD

Human Growth Peptide Cjc-1295 No Dac for Muscle Enhance

What is cjc-1295? 1. Cjc-1295 is also referred to as Mod GRF 1-29, which in most cases is recommended to exceed CJC-1295. The duration of the effect of the product is different. MOD GRF shortens the desired duration of the drug, and CJC-1295 has the effect of preventing the ...

wuhanmingyue

2 mg/vial Peptides CJC-1295 DAC CAS 863288-34-0

CJC-1295 DAC has shown some amazing results as a hormone releasing hormone (GHRH) analog. Not only has CJC-1295 shown the ability to increase hormone and secretion and its benefits, but it has been able to do so in very large amounts. Recent research studies have shown that CJC ...

Wuhan Dahua Biotechnology Co., Ltd

CJC1295 With DAC 2mg/Vial Peptide powder

CAS 863288-34-0 CJC-1295 Safe and High quality China made Peptides CAS 863288-34-0 Growth Hormone Releasing Hormones (GHRH) Product name: CJC-1295,GHRH CAS Registry Number: 863288-34-0 Appearance: White Powder Grade: Pharmaceutical Grade Wuhan Demeikai Biotechnology Co., Ltd is ...

Wuhan Dahua Biotechnology Co., Ltd

High quality CAS 863288-34-0 CJC-1295 Acetate

CAS 863288-34-0 CJC-1295 Acetate Product name: CJC-1295 Acetate Alias:GHRH, Growth Hormone Releasing Hormones,MOD GRF 1-29 CAS Registry Number: 863288-34-0 Appearance: White Powder Purity:98% Grade: Pharmaceutical Grade Storage: Shading, confined preservation CJC-1295 Effect ...

Hangzhou Fuluo Biological Co.ltd

CJC1295

CJC-1295 Ohter name: Mod GRF, GHRH,CJC-1295 noDAC,MOD GRF 1-29,Modified GRF 1-29 Effects: boost protein synthesis, increased growth of muscle tissue ,helps injury recovery times,reduce body fat, boost immune system and bone density and cellular repair (skin and organs) CJC1295 ...

fewrfeggth

CJC1295

fewrfeggth

CJC1295dac

CJC 1295 with DAC other name: CJC1295dac, CJC1295withDAC Product Description: CJC-1295 2mg/Vial CJC1295dac Type: Immune Function AgentsGrade CJC1295dac Standard: Medicine Grade CJC1295dac Classification: Brassinosteroid CJC1295dac MF: C165H271N47O46 CJC1295dac Molecular Weight: ...

fewrfeggth