GRF (1-44) (HUMAN)
Product Name: GRF (1-44) (HUMAN)
Synonyms: SERMORELIN (HUMAN);SOMATOCRININ (HUMAN);SOMATOLIBERIN
(HUMAN);SOMATORELIN;YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2;TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-GLN-GLN-GLY-GLU-SER-ASN-GLN-GLU-ARG-GLY-ALA-ARG-ALA-ARG-LEU-NH2;H-TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-GLN-GLN-GLY-GLU-SER-ASN-GLN-GLU-ARG-GLY-ALA-ARG-ALA-ARG-LEU-NH2;H-TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-GLN-GLN-GLY-GLU-SER-ASN-GLN-GLU-ARG-GLY-ALA-ARG-ALA-ARG-LEU-OH
CAS: 83930-13-6
MF: C215H358N72O66S1
MW: 5039.65
EINECS:
Product Categories: Peptide;VIP and PACAP receptor
Mol File: Mol File
form: powder
Our advantage:
1. Rich experience.
We specialize in this field for many years, our steroids and hormones exported to Overseas, to Europe, Africa, Asia and Americas and so on other country, and we have got very good feedback from our
customers, and had Established long friendly relations of cooperation.
2. Great quality, purity and favourable.
Good quality is one of our secret success, welcome order the samples, MOQ just 10 grams.
3. Safest and fastest delivery.
We have Adequate stock, and can delivery quickly at the very day when receive the payment.
We have special way could ship 0.01 kilo to 3.5 kilo products a time. We offer melting powder into liquid service. And ship the liquid in special bottles.
4. Good after-sales service.
Tell the package update ASAP, and will try best solve when customer encountered various.
Email:sales09 at ycphar dom com
Skype:sales09_109
Telephone:86-027-50756084
Mobile:86-18872220656