We offer high quality Research Chemicals Transportation: DHL,FEDEX,UPS.EMS hot selling research chemicals: 5F-PCN 5F-NNEI(5F-MN24) 2nmc 4cmc 4cpvpapvp Dibutylone Adrafinil 4FPHP 5-MEO-NEPTmipt,dmt mphp BB22 ADB-CHMINACA MAB-CHMINACA FUB-AKB48 SDb005 NM2201 MMB2201 ro-8 ...
Wuhan Tuoke Biotechnology Co.Ltd. [Chemicals] [Pharmaceutical Chemicals] [2017-10-19 15:11:08 ]
Creative Peptides offers HLA-A_24_02 HBV pol tetramer-KYTSFPWLL-APC labeled which can be used for direct detection of antigen specific T cells. Visit https://www.creative-peptides.com/product/hla-a-hbv-pol-tetramer-kytsfpwll-apc-labeled-item-cpm-1-0033-33873.html for more ...
Creative Peptides [Chemicals] [Pharmaceutical Chemicals] [2017-10-16 14:25:35 ]
Creative Peptides offers HLA-A_01_01 CMV pp50 tetramer-VTEHDTLLY-APC labeled which can be used for direct detection of antigen specific T cells. Visit https://www.creative-peptides.com/product/hla-a-cmv-pp50-tetramer-vtehdtlly-apc-labeled-item-cpm-1-0035-33875.html for more ...
Creative Peptides [Chemicals] [Pharmaceutical Chemicals] [2017-10-16 14:23:37 ]
Creative Peptides offers HLA-A_24_02 hTERT tetramer-VYGFVRACL-PE labeled which can be used for direct detection of antigen specific T cells. Visit https://www.creative-peptides.com/product/hla-a-htert-tetramer-vygfvracl-pe-labeled-item-cpm-1-0036-33876.html for more ...
Creative Peptides [Chemicals] [Pharmaceutical Chemicals] [2017-10-16 14:23:10 ]
Creative Peptides offers HLA-E_01_03 HLA-A leader3-11 tetramer-VMAPRTLVL-PE labeled which can be used for direct detection of antigen specific T cells. Visit https://www.creative-peptides.com/product/hla-e-hla-a-leader3-tetramer-vmaprtlvl-pe-labeled-item-cpm-1-0037-33877.html ...
Creative Peptides [Chemicals] [Pharmaceutical Chemicals] [2017-10-16 14:21:07 ]
Creative Peptides offers H-2Ld HBsAg tetramer-IPQSLDSWWTSL-PE labeled which can be used for direct detection of antigen specific T cells. Visit https://www.creative-peptides.com/product/h-2ld-hbsag-tetramer-ipqsldswwtsl-pe-labeled-item-cpm-1-0039-33879.html for more ...
Creative Peptides [Chemicals] [Pharmaceutical Chemicals] [2017-10-16 14:18:15 ]
Creative Peptides offers HLA-A_11_01 CMV pp65 tetramer-ATVQGQNLK-PE labeled which can be used for direct detection of antigen specific T cells. Visit https://www.creative-peptides.com/product/hla-a-cmv-pp65-tetramer-atvqgqnlk-pe-labeled-item-cpm-1-0040-33880.html for more ...
Creative Peptides [Chemicals] [Pharmaceutical Chemicals] [2017-10-16 14:16:28 ]
We are dedicated to offering custom peptide synthesis, process development, GMP manufacturing as well as catalog products for customers in industry and research area. Creative Peptides is specialized in the process development and the manufacturing of bioactive peptides. ...
Creative Peptides [Chemicals] [Pharmaceutical Chemicals] [2017-10-16 14:14:40 ]
We are dedicated to offering custom peptide synthesis, process development, GMP manufacturing as well as catalog products for customers in industry and research area. Synonyms/Alias GS peptide-2 CAS No. 851366-97-7 Sequence YRRAAVPPSPSLSRHSSPHQSEDEEE (Modifications: Ser-21 = ...
Creative Peptides [Chemicals] [Pharmaceutical Chemicals] [2017-10-16 14:13:43 ]
Creative Peptides is specialized in the process development and the manufacturing of bioactive peptides. We are dedicated to offering custom peptide synthesis, process development, GMP manufacturing as well as catalog products for customers in industry and research area. We ...
Creative Peptides [Chemicals] [Pharmaceutical Chemicals] [2017-10-16 14:12:46 ]
CAS No. 195262-56-7 Sequence HADGSFSDEMNTILDNLATRDFINWLIQTKITD M.W/Mr. 3796.17 Molecular Formula C166H256N44O56S Application Endogenous peptide identified as an intestinal epithelium-specific growth factor; stimulates cell proliferation and inhibits apoptosis. Diverse effects ...
Creative Peptides [Chemicals] [Pharmaceutical Chemicals] [2017-10-16 14:12:09 ]
Sequence KRMKVAKSAQ M.W/Mr. 1146.42 Molecular Formula C48H91N17O13S Storage -20°C Creative Peptides is specialized in the process development and the manufacturing of bioactive peptides. We are dedicated to offering custom peptide synthesis, process development, GMP ...
Creative Peptides [Chemicals] [Pharmaceutical Chemicals] [2017-10-16 14:10:18 ]
Creative Peptides is specialized in the process development and the manufacturing of bioactive peptides. We are dedicated to offering custom peptide synthesis, process development, GMP manufacturing as well as catalog products for customers in industry and research area. We ...
Creative Peptides [Chemicals] [Pharmaceutical Chemicals] [2017-10-16 14:08:21 ]
We provide Pep1-AGL. More information please visit our website: https://www.creative-peptides.com/product/pep1-agl-item-r0833-34635.html CAT#R0833 SequenceSSGMPLGAAGL M.W/Mr.960.11 Molecular FormulaC40H69N11O14S Storage-20°C Creative Peptides is specialized in the process ...
Creative Peptides [Chemicals] [Pharmaceutical Chemicals] [2017-10-16 14:05:57 ]
We are dedicated to offering custom peptide synthesis, process development, GMP manufacturing as well as catalog products for customers in industry and research area. CAT# R0832 CAS No. 5991-13-9 Sequence RFPSFGPPR M.W/Mr. 1060.22 Molecular Formula C50H73N15O11 Storage -20°C ...
Creative Peptides [Chemicals] [Pharmaceutical Chemicals] [2017-10-16 14:04:11 ]
Creative Peptides is specialized in the process development and the manufacturing of bioactive peptides. We are dedicated to offering custom peptide synthesis, process development, GMP manufacturing as well as catalog products for customers in industry and research area. ...
Creative Peptides [Chemicals] [Pharmaceutical Chemicals] [2017-10-16 14:03:19 ]
Creative Peptides is specialized in the process development and the manufacturing of bioactive peptides. We are dedicated to offering custom peptide synthesis, process development, GMP manufacturing as well as catalog products for customers in industry and research area. CAS ...
Creative Peptides [Chemicals] [Pharmaceutical Chemicals] [2017-10-16 14:02:26 ]
Creative Peptides is specialized in the process development and the manufacturing of bioactive peptides. We are dedicated to offering custom peptide synthesis, process development, GMP manufacturing as well as catalog products for customers in industry and research area. ...
Creative Peptides [Chemicals] [Pharmaceutical Chemicals] [2017-10-16 14:01:32 ]
Creative Peptides is specialized in the process development and the manufacturing of bioactive peptides. We are dedicated to offering custom peptide synthesis, process development, GMP manufacturing as well as catalog products for customers in industry and research area. Visit ...
Creative Peptides [Chemicals] [Pharmaceutical Chemicals] [2017-10-16 13:59:23 ]
Creative Peptides is specialized in the process development and the manufacturing of bioactive peptides. We are dedicated to offering custom peptide synthesis, process development, GMP manufacturing as well as catalog products for customers in industry and research area. Visit ...
Creative Peptides [Chemicals] [Pharmaceutical Chemicals] [2017-10-16 13:55:43 ]
