CAS No. 195262-56-7 Sequence HADGSFSDEMNTILDNLATRDFINWLIQTKITD M.W/Mr. 3796.17 Molecular Formula C166H256N44O56S Application Endogenous peptide identified as an intestinal epithelium-specific growth factor; stimulates cell proliferation and inhibits apoptosis. Diverse effects ...
Creative Peptides [Chemicals] [Pharmaceutical Chemicals] [2017-10-16 14:12:09 ]
Product Name Filing cabinet Brand Feng Long Model FC-N3-3 Dimension H1031mm*W452mm*D620mm, per customer`s requirement Packing Volume 0.069CBM Place of origin HENAN,LUOYANG Colour custom Steel Thickness 0.6mm as regular, 0.5-1.2mm available Function Office furniture Port ...
LUOYANG FENGLONG OFFICE FURNITURE CO.,LTD [Furniture] [Metal Furniture] [2017-10-16 14:11:15 ]
Sequence KRMKVAKSAQ M.W/Mr. 1146.42 Molecular Formula C48H91N17O13S Storage -20°C Creative Peptides is specialized in the process development and the manufacturing of bioactive peptides. We are dedicated to offering custom peptide synthesis, process development, GMP ...
Creative Peptides [Chemicals] [Pharmaceutical Chemicals] [2017-10-16 14:10:18 ]
4mm fan metal guard Place of Origin:China (Mainland) port:shenzhen Brand Name:greatcooler Packaging & Delivery Packaging Details:standard package Delivery Detail:Shipped in 15-25 days after payment. If you have any needs , pls feel free contact me . ...
Greatcooler Electronic Technology Co.,LTD [Consumer Electronics] [Other Consumer Electronics] [2017-10-16 14:09:56 ]
Creative Peptides is specialized in the process development and the manufacturing of bioactive peptides. We are dedicated to offering custom peptide synthesis, process development, GMP manufacturing as well as catalog products for customers in industry and research area. We ...
Creative Peptides [Chemicals] [Pharmaceutical Chemicals] [2017-10-16 14:08:21 ]
Item Specifications Product Name Steel cabinet Brand Feng Long Model SC-L1 Dimension H900mm*W400mm*D900mm, per customer`s requirement Packing Volume 0.093CBM Place of origin HENAN,LUOYANG Colour custom Steel Thickness 0.6mm as regular, 0.5-1.2mm available Function Office ...
LUOYANG FENGLONG OFFICE FURNITURE CO.,LTD [Furniture] [Metal Furniture] [2017-10-16 14:07:55 ]
We provide Pep1-AGL. More information please visit our website: https://www.creative-peptides.com/product/pep1-agl-item-r0833-34635.html CAT#R0833 SequenceSSGMPLGAAGL M.W/Mr.960.11 Molecular FormulaC40H69N11O14S Storage-20°C Creative Peptides is specialized in the process ...
Creative Peptides [Chemicals] [Pharmaceutical Chemicals] [2017-10-16 14:05:57 ]
We are dedicated to offering custom peptide synthesis, process development, GMP manufacturing as well as catalog products for customers in industry and research area. CAT# R0832 CAS No. 5991-13-9 Sequence RFPSFGPPR M.W/Mr. 1060.22 Molecular Formula C50H73N15O11 Storage -20°C ...
Creative Peptides [Chemicals] [Pharmaceutical Chemicals] [2017-10-16 14:04:11 ]
Creative Peptides is specialized in the process development and the manufacturing of bioactive peptides. We are dedicated to offering custom peptide synthesis, process development, GMP manufacturing as well as catalog products for customers in industry and research area. ...
Creative Peptides [Chemicals] [Pharmaceutical Chemicals] [2017-10-16 14:03:19 ]
Creative Peptides is specialized in the process development and the manufacturing of bioactive peptides. We are dedicated to offering custom peptide synthesis, process development, GMP manufacturing as well as catalog products for customers in industry and research area. CAS ...
Creative Peptides [Chemicals] [Pharmaceutical Chemicals] [2017-10-16 14:02:26 ]
Creative Peptides is specialized in the process development and the manufacturing of bioactive peptides. We are dedicated to offering custom peptide synthesis, process development, GMP manufacturing as well as catalog products for customers in industry and research area. ...
Creative Peptides [Chemicals] [Pharmaceutical Chemicals] [2017-10-16 14:01:32 ]
Creative Peptides is specialized in the process development and the manufacturing of bioactive peptides. We are dedicated to offering custom peptide synthesis, process development, GMP manufacturing as well as catalog products for customers in industry and research area. Visit ...
Creative Peptides [Chemicals] [Pharmaceutical Chemicals] [2017-10-16 13:59:23 ]
mail: cherry@zwytech.com Whatsapp:+86-17138902165 Zhongweiye biological technology co.,ltd Website: http://biologica.ecer.com/ 1 Product name 4-MPD 2 Full chemical name 1-(4-Methylphenyl)-2-methylamino-pentan-1-one 3 Formal Name ...
zhongweiye biological technology co.,limited [Chemicals] [Pharmaceutical Intermediates] [2017-10-16 13:59:07 ]
Creative Peptides is specialized in the process development and the manufacturing of bioactive peptides. We are dedicated to offering custom peptide synthesis, process development, GMP manufacturing as well as catalog products for customers in industry and research area. Visit ...
Creative Peptides [Chemicals] [Pharmaceutical Chemicals] [2017-10-16 13:55:43 ]
Creative Peptides is specialized in the process development and the manufacturing of bioactive peptides. We are dedicated to offering custom peptide synthesis, process development, GMP manufacturing as well as catalog products for customers in industry and research area. Visit ...
Creative Peptides [Chemicals] [Pharmaceutical Chemicals] [2017-10-16 13:52:17 ]
Alfa Chemistry offers an extensive catalog of building blocks, reagents, catalysts, reference materials, and research chemicals. We supply Glycyl-L-Histidyl-L-Lysine. More information please visit the website: ...
Alfa Chemistry [Chemicals] [Chemicals for Daily Use] [2017-10-16 13:48:33 ]
CAS Number 49557-75-7 Synonyms GHK Cu Copper Peptide Molecular Weight 340.39 Molecular Formula C14H24N6O4 Description Whitening and removing wrinkles Alfa Chemistry offers an extensive catalog of building blocks, reagents, catalysts, reference materials, and research chemicals. ...
Alfa Chemistry [Chemicals] [Chemicals for Daily Use] [2017-10-16 13:47:55 ]
Alfa Chemistry offers an extensive catalog of building blocks, reagents, catalysts, reference materials, and research chemicals. We supply Amygdalin. More information please visit the website: https://www.alfa-chemistry.com/genistein-cas-446-72-0-item-284864.htm CAS Number ...
Alfa Chemistry [Chemicals] [Chemicals for Daily Use] [2017-10-16 13:47:22 ]
Alfa Chemistry offers an extensive catalog of building blocks, reagents, catalysts, reference materials, and research chemicals. We supply Glycyrrhetinic Acid. More information please visit the website: https://www.alfa-chemistry.com/amygdalin-cas-29883-15-6-item-291363.htm CAS ...
Alfa Chemistry [Chemicals] [Chemicals for Daily Use] [2017-10-16 13:46:49 ]
CAS Number 471-53-4 Molecular Weight 470.69 Molecular Formula C30H46O4 Purity 98% (HPLC) Appearance almost white crystal powder Effective constituent Enoxolone Description Effect on adrenocortical hormone Anti-inflammatory and immunization effect Effect on digestive system ...
Alfa Chemistry [Chemicals] [Chemicals for Daily Use] [2017-10-16 13:46:09 ]
