Searching 2 and 2 , total 50117 products,queries done in 27 ms

Remote card copy UHF card copy UHF6C white card / UHF card / 915M card / G2 white card Aikeyi

Remote card copy UHF card copy UHF6C white card / UHF card / 915M card / G2 white card Aikeyi Technology (Contact:Mia.WeChat:aky_01,Skype:13423626252,QQ:2880179620,WhatsApp:15011978320) High frequency smart card, HF smart card Product Features: 1. International Standard: ISO / ...

Guangzhou AIKEYI Smart Card Technology Co.,Ltd.    [Packaging & Printing]   [Printing Services]   [2017-10-20 09:22:23 ]

4-layer 2oz Peelable Mask PCB

4-layer 2oz Peelable Mask PCB 1. PCB P/N:2876414 2. Layer: 4L 3. Base material: FR-4 4. Board thickness: 1.6mm 5. Final copper: 70um 6. Surface finish: Immersion gold, Au: 3uā€ min. 7. Solder mask: Green 8. Profile: Routing + v-cut 9. E-test: 100% fixture 10. Special ...

O-LEADING SUPPLY CHAIN (HK) CO.,LIMITED    [Electronic Components & Supplies]   [Passive Components]   [2017-10-19 13:42:02 ]

Cryogenic ln2 tank 60L liquid nitrogen gas cylinder manufacturer in GE

Cryogenic ln2 tank 60L liquid nitrogen gas cylinder manufacturer in GE Portable liquid nitrogen container the use of high-strength aerospace aluminum manufacturing,The product is easy to long-term preservation of biological specimens, easy to carry;Used in molecular cuisine, ...

Tianchi    [Chemicals]   [Chemical Machinery & Equipment]   [2017-10-18 17:19:36 ]

2-Oxo-PCM from China E-mail: rita@tkbiotechnology.com

Common names :Deschloroketamine, DCK, DXE, O-PCM Substitutive name:Deschloroketamine Systematic name :2-Phenyl-2-(methylamino)cyclohexanone Deschloroketamine, or 2-Phenyl-2-(methylamino)cyclohexanone, is classed as an arylcyclohexylamine Descholoroketamine is a chiral molecule ...

Wuhan Tuoke Biotechnology Co.,Ltd    [Health & Medical]   [Health Care Products]   [2017-10-18 13:56:09 ]

2-FDCK from China E-mail: rita@tkbiotechnology.com

2-FDCK CAS No. 4631-27-0 Purity: >99% Storage: in cool and dry place Application: lab research Model No.: top grade Min.Order: 1 Gram Means of Transport: Land, Ocean, Air Production Capacity: 500kg/month Packing:Aluminum foil bag--Inner double plastic bags ...

Wuhan Tuoke Biotechnology Co.,Ltd    [Health & Medical]   [Health Care Products]   [2017-10-18 13:48:17 ]

2c-b from China E-mail: rita@tkbiotechnology.com

Molecular Formula:C10H14BrNO2 IUPAC Molar mass: 260.13 g/mol 2C-B is a psychedelic drug. It was first synthesized by Alexander Shulgin in 1974. In Shulgin\'s book PiHKAL, the dosage range is listed as 12ā€“24 mg. 2C-B is sold as a white powder sometimes pressed in tablets or ...

Wuhan Tuoke Biotechnology Co.,Ltd    [Health & Medical]   [Health Care Products]   [2017-10-18 13:46:51 ]

H-2Ld HBsAg tetramer-IPQSLDSWWTSL-PE labeled

Creative Peptides offers H-2Ld HBsAg tetramer-IPQSLDSWWTSL-PE labeled which can be used for direct detection of antigen specific T cells. Visit https://www.creative-peptides.com/product/h-2ld-hbsag-tetramer-ipqsldswwtsl-pe-labeled-item-cpm-1-0039-33879.html for more ...

Creative Peptides    [Chemicals]   [Pharmaceutical Chemicals]   [2017-10-16 14:18:15 ]

Phospho-Glycogen Synthase Peptide-2 (substrate)

We are dedicated to offering custom peptide synthesis, process development, GMP manufacturing as well as catalog products for customers in industry and research area. Synonyms/Alias GS peptide-2 CAS No. 851366-97-7 Sequence YRRAAVPPSPSLSRHSSPHQSEDEEE (Modifications: Ser-21 = ...

Creative Peptides    [Chemicals]   [Pharmaceutical Chemicals]   [2017-10-16 14:13:43 ]

GLP-2 (rat)

CAS No. 195262-56-7 Sequence HADGSFSDEMNTILDNLATRDFINWLIQTKITD M.W/Mr. 3796.17 Molecular Formula C166H256N44O56S Application Endogenous peptide identified as an intestinal epithelium-specific growth factor; stimulates cell proliferation and inhibits apoptosis. Diverse effects ...

Creative Peptides    [Chemicals]   [Pharmaceutical Chemicals]   [2017-10-16 14:12:09 ]

pep2-SVKE

Creative Peptides is specialized in the process development and the manufacturing of bioactive peptides. We are dedicated to offering custom peptide synthesis, process development, GMP manufacturing as well as catalog products for customers in industry and research area. We ...

Creative Peptides    [Chemicals]   [Pharmaceutical Chemicals]   [2017-10-16 14:08:21 ]

2 doors hang the garment bag integrated ark metal steel cabinet

Item Specifications Product Name Steel cabinet Brand Feng Long Model SC-L1 Dimension H900mm*W400mm*D900mm, per customer`s requirement Packing Volume 0.093CBM Place of origin HENAN,LUOYANG Colour custom Steel Thickness 0.6mm as regular, 0.5-1.2mm available Function Office ...

LUOYANG FENGLONG OFFICE FURNITURE CO.,LTD    [Furniture]   [Metal Furniture]   [2017-10-16 14:07:55 ]

Methoxyacetylfentanyl (MAF) 2-me-maf 4-me-maf vendor (whatsapp:+86-17138902165)

mail: cherry@zwytech.com Whatsapp:+86-17138902165 Zhongweiye biological technology co.,ltd Website: http://biologica.ecer.com/ More products we can offer: Methoxyacetylfentanyl (MAF), Furanylfentanyl FUF bk-ebdp crystal,5F-ADB,5f-mdmb2201,5f-amb 4F-PET,4F-MPH Fub-amb, ...

zhongweiye biological technology co.,limited    [Chemicals]   [Pharmaceutical Intermediates]   [2017-10-16 11:50:40 ]

METHYL 2-FUROATE

2-Furancarboxylic acid, methyl ester, METHYL 2-FUROATE BOC Sciences is committed to supplying cost-effective products and services. We provide METHYL 2-FUROATE. More information please visit: https://www.bocsci.com/methyl-2-furoate-cas-611-13-2-item-73035.html colorless to ...

BOC Sciences    [Chemicals]   [Flavour & Fragrance]   [2017-10-16 11:45:07 ]

PRENOL (3-METHYL-2-BUTEN-1-OL)

BOC Sciences is committed to supplying cost-effective products and services. We provide PRENOL (3-METHYL-2-BUTEN-1-OL). More information please visit: https://www.bocsci.com/prenol-3-methyl-2-buten-1-ol-cas-556-82-1-item-71552.html 2-Buten-1-ol, 3-methyl-, 3,3-Dimethylallyl ...

BOC Sciences    [Chemicals]   [Flavour & Fragrance]   [2017-10-16 11:43:29 ]

trans-2-HEXENOIC ACID

BOC Sciences is committed to supplying cost-effective products and services. We provide trans-2-HEXENOIC ACID. More information please visit: https://www.bocsci.com/trans-2-hexenoic-acid-cas-13419-69-7-item-83375.html FEMA 3169 Odor description A cheesy, fatty odor. Taste ...

BOC Sciences    [Chemicals]   [Flavour & Fragrance]   [2017-10-16 11:40:05 ]

2,4-HEXADIEN-1-AL

BOC Sciences is committed to supplying cost-effective products and services. We provide 2,4-HEXADIEN-1-AL. More information please visit: https://www.bocsci.com/2-4-hexadien-1-al-cas-142-83-6-item-84010.html FEMA 3429 Odor description Fatty, sweet, green aldehydic odor with a ...

BOC Sciences    [Chemicals]   [Flavour & Fragrance]   [2017-10-16 11:38:52 ]

2,4-HEXADIENYL ACETATE

FEMA 4132 Odor description A powerful, sweet, pineapple odor. Purity 98.0% Appearance colorless liquid Synonyms 2,4-Hexadien-1-ol, acetate, 2,4-HEXADIENYL ACETATE, Sorbyl acetate Solubility Insoluble in water; soluble in alcohol. Storage Store tightly sealed under inert gas in ...

BOC Sciences    [Chemicals]   [Flavour & Fragrance]   [2017-10-16 11:38:15 ]

trans-2-OCTEN-1-OL

BOC Sciences is committed to supplying cost-effective products and services. We provide trans-2-OCTEN-1-OL. More information please visit: https://www.bocsci.com/trans-2-octen-1-ol-cas-18409-17-1-item-86275.html FEMA 3887 Odor description A green, vegetable-like odor. Taste ...

BOC Sciences    [Chemicals]   [Flavour & Fragrance]   [2017-10-16 11:36:01 ]

2,4-DECADIEN-1-OL

Odor description A waxy, citrus character. Taste description Fatty, oily. Purity 95.0% (sum of isomers) Appearance colorless liquid Synonyms (* Alt. CAS #) CAS: 14507-02-9; 2,4-Decadienol, (E,E)-2,4-Decadienol, 2,4-DECADIEN-1-OL, 2,4-Decadien-1-ol, (2E,4E)-, 2,4-Decadienol, ...

BOC Sciences    [Chemicals]   [Flavour & Fragrance]   [2017-10-16 11:35:27 ]

trans-2-NONEN-1-AL FCC

FEMA 3213 Odor description Green, aldeydic, bright odor with persistent fatty, carrot leaf, and melon notes. Taste description Sweet, fatty, citrus, melon. Purity 97.0% (sum of isomers) Appearance white to slightly yellow liquid Synonyms (* Alt. CAS #) CAS: 2463-53-8; ...

BOC Sciences    [Chemicals]   [Flavour & Fragrance]   [2017-10-16 11:34:50 ]