Jetpeel Skin SPA Hydrafacial Dermabrasion Skin Rejuvenation Oxygen Facial Machine Beauty Equipment/ H200 Why our skins need oxygen? 98% of the skin is made up of collagen.The elder we are,the less oxygen our blood carries,which will fail collagen to regenerate. Meanwhile, skin ...
iTech Aesthetics Limited [Beauty & Personal Care] [Beauty Equipment] [2017-10-17 13:48:36 ]
Shockwave Therapy Machine / SW8 Shock wave work therapy: A shockwave is defined as a wave with a rapid increase of pressure within a very short time and then having a gradual decrease of pressure with a small negative pressure phase. Shockwave is aimed at the affected areas that ...
iTech Aesthetics Limited [Beauty & Personal Care] [Beauty Equipment] [2017-10-17 13:43:25 ]
Radial Shockwave Therapy Extracorporeal Shock Wave Therapy ESWT Treatment for Heel Spurs & Back Pain Shockwave Therapy Shockwave therapy is a multidisciplinary device used in orthopaedics, physiotherapy, sports medicine, urology and veterinary medicine. Its main assets are fast ...
iTech Aesthetics Limited [Beauty & Personal Care] [Beauty Equipment] [2017-10-17 13:41:56 ]
Hydraulic Orbit Motor BMH: *Advanced manufacturing devices for the Gerolor gear set, which use low pressure of start-up,provide smooth, reliable operation and high efficiency. *Shaft seal can bear high pressure of back and the motor can be used in parallel or series. *Special ...
Shijiazhuang Hanjiu Technology Co.,Ltd [Tools] [Hydraulic Tools] [2017-10-16 17:09:20 ]
Hydraulic Orbit Motor BMP BMP series motor are small volume, economical type, which is designed with shaft distribution flow, which adapt the Gerotor gear set design and provide compact volume, high power and low weigth. Characteristic Features: * Advanced manufacturing devices ...
Shijiazhuang Hanjiu Technology Co.,Ltd [Tools] [Hydraulic Tools] [2017-10-16 17:02:33 ]
H3 electronic label international standard white card Aikeyi Technology WeChat:aky_01,Skype:13423626252,QQ:2880179620,WhatsApp:15011978320) About H3 electronic tags project description Remarks Manufacturer / chip Alien/Higgs3 Base material PET Antenna process mode Aluminum ...
Guangzhou AIKEYI Smart Card Technology Co.,Ltd. [Packaging & Printing] [Printing Services] [2017-10-16 15:40:55 ]
Features: 1: HD: 960P(1280*960), 1.3 MP, H.264. 2: Night Vision: Adopt new starlight level sensor, with shimmer night visioin is full color, IR distance 20M. 3: Lens: 4mm, F16 Starlight level Lens with better ngith vision. 4: microSD Card: Supports upto 64GB microSD card for ...
Shenzhen Sricctv Technology Co.Ltd. [Security & Protection] [CCTV Camera] [2017-10-16 14:26:22 ]
Creative Peptides offers HLA-A_24_02 hTERT tetramer-VYGFVRACL-PE labeled which can be used for direct detection of antigen specific T cells. Visit https://www.creative-peptides.com/product/hla-a-htert-tetramer-vygfvracl-pe-labeled-item-cpm-1-0036-33876.html for more ...
Creative Peptides [Chemicals] [Pharmaceutical Chemicals] [2017-10-16 14:23:10 ]
Creative Peptides offers H-2Ld HBsAg tetramer-IPQSLDSWWTSL-PE labeled which can be used for direct detection of antigen specific T cells. Visit https://www.creative-peptides.com/product/h-2ld-hbsag-tetramer-ipqsldswwtsl-pe-labeled-item-cpm-1-0039-33879.html for more ...
Creative Peptides [Chemicals] [Pharmaceutical Chemicals] [2017-10-16 14:18:15 ]
Product Name steel almirah designs metal clothes locker cabinet Brand Feng Long Model SL-A2-2 Dimension H1850mm*W380mm*D450mm, per customer`s requirement Packing Volume 0.05CBM Quantity /20GP 560 PCS Quantity /40HQ 1360 PCS Steel Thickness 0.6mm as regular, 0.5-1.2mm available ...
LUOYANG FENGLONG OFFICE FURNITURE CO.,LTD [Furniture] [Metal Furniture] [2017-10-16 14:15:59 ]
We are dedicated to offering custom peptide synthesis, process development, GMP manufacturing as well as catalog products for customers in industry and research area. Creative Peptides is specialized in the process development and the manufacturing of bioactive peptides. ...
Creative Peptides [Chemicals] [Pharmaceutical Chemicals] [2017-10-16 14:14:40 ]
We are dedicated to offering custom peptide synthesis, process development, GMP manufacturing as well as catalog products for customers in industry and research area. Synonyms/Alias GS peptide-2 CAS No. 851366-97-7 Sequence YRRAAVPPSPSLSRHSSPHQSEDEEE (Modifications: Ser-21 = ...
Creative Peptides [Chemicals] [Pharmaceutical Chemicals] [2017-10-16 14:13:43 ]
Creative Peptides is specialized in the process development and the manufacturing of bioactive peptides. We are dedicated to offering custom peptide synthesis, process development, GMP manufacturing as well as catalog products for customers in industry and research area. We ...
Creative Peptides [Chemicals] [Pharmaceutical Chemicals] [2017-10-16 14:12:46 ]
CAS No. 195262-56-7 Sequence HADGSFSDEMNTILDNLATRDFINWLIQTKITD M.W/Mr. 3796.17 Molecular Formula C166H256N44O56S Application Endogenous peptide identified as an intestinal epithelium-specific growth factor; stimulates cell proliferation and inhibits apoptosis. Diverse effects ...
Creative Peptides [Chemicals] [Pharmaceutical Chemicals] [2017-10-16 14:12:09 ]
Product Name Filing cabinet Brand Feng Long Model FC-N3-3 Dimension H1031mm*W452mm*D620mm, per customer`s requirement Packing Volume 0.069CBM Place of origin HENAN,LUOYANG Colour custom Steel Thickness 0.6mm as regular, 0.5-1.2mm available Function Office furniture Port ...
LUOYANG FENGLONG OFFICE FURNITURE CO.,LTD [Furniture] [Metal Furniture] [2017-10-16 14:11:15 ]
Sequence KRMKVAKSAQ M.W/Mr. 1146.42 Molecular Formula C48H91N17O13S Storage -20°C Creative Peptides is specialized in the process development and the manufacturing of bioactive peptides. We are dedicated to offering custom peptide synthesis, process development, GMP ...
Creative Peptides [Chemicals] [Pharmaceutical Chemicals] [2017-10-16 14:10:18 ]
Creative Peptides is specialized in the process development and the manufacturing of bioactive peptides. We are dedicated to offering custom peptide synthesis, process development, GMP manufacturing as well as catalog products for customers in industry and research area. We ...
Creative Peptides [Chemicals] [Pharmaceutical Chemicals] [2017-10-16 14:08:21 ]
Item Specifications Product Name Steel cabinet Brand Feng Long Model SC-L1 Dimension H900mm*W400mm*D900mm, per customer`s requirement Packing Volume 0.093CBM Place of origin HENAN,LUOYANG Colour custom Steel Thickness 0.6mm as regular, 0.5-1.2mm available Function Office ...
LUOYANG FENGLONG OFFICE FURNITURE CO.,LTD [Furniture] [Metal Furniture] [2017-10-16 14:07:55 ]
We provide Pep1-AGL. More information please visit our website: https://www.creative-peptides.com/product/pep1-agl-item-r0833-34635.html CAT#R0833 SequenceSSGMPLGAAGL M.W/Mr.960.11 Molecular FormulaC40H69N11O14S Storage-20°C Creative Peptides is specialized in the process ...
Creative Peptides [Chemicals] [Pharmaceutical Chemicals] [2017-10-16 14:05:57 ]
We are dedicated to offering custom peptide synthesis, process development, GMP manufacturing as well as catalog products for customers in industry and research area. CAT# R0832 CAS No. 5991-13-9 Sequence RFPSFGPPR M.W/Mr. 1060.22 Molecular Formula C50H73N15O11 Storage -20°C ...
Creative Peptides [Chemicals] [Pharmaceutical Chemicals] [2017-10-16 14:04:11 ]
