We are a professional factory which has been specialized in manufacturing diesel fuel injection parts for about 25 years.Our majored products is Ve Pump and the interrelated products,such as common rail parts,head rotor,plunger,nozzle,pencil nozzle,cummins system,repair ...
China-Lutong Parts Plant [Automobiles & Motorcycles] [Auto Engine] [2017-10-18 15:13:08 ]
Anping Tenglu Metal Wire Mesh Co.,LTD Nickel 200 Wire Mesh Woven nickel mesh has plain weave, twill weave, Holland weave, twill Holland weave, reverse Holland weaving five methods. The nickel net is mainly used for screening in acid and alkali environment and separating gas, ...
Anping Tenglu metal Wire Mesh Co.LTD [Minerals & Metallurgy] [Nickel] [2017-10-17 20:08:16 ]
Anping Tenglu Metal Wire Mesh Co.,LTD Mild Steel A142 /A393 Reinforcing Mesh A142 Mild Steel Mesh is used widely across a range of industries and sectors. Reinforcing Mesh is most often used in the construction industry for reinforcing concrete slabs in floors and other ...
Anping Tenglu metal Wire Mesh Co.LTD [Construction & Real Estate] [Metal Building Materials] [2017-10-17 20:06:41 ]
Anping Tenglu Metal Wire Mesh Co.,LTD High Carbon Steel Wire Mesh The diameter range of them is from 0.25mm to 16mm. Features: High tensile strength Light weight Highly resistant to abrasions and wear & tear Portability Rigid construction Resistance against corrosion Ability to ...
Anping Tenglu metal Wire Mesh Co.LTD [Minerals & Metallurgy] [Steel Wire Mesh] [2017-10-17 20:04:30 ]
Anping Tenglu Metal Wire Mesh Co.,LTD Crimped Wire Mesh Screen Material: high carbon steel Weave Style: crimped Wire Diameter: 0.5-10mm The crimped woven wire mesh has square opening and rectangle opening, which has different wire diameters and applications.The pre-crimped ...
Anping Tenglu metal Wire Mesh Co.LTD [Minerals & Metallurgy] [Stainless Steel Wire Mesh] [2017-10-17 19:56:37 ]
100Mpa industrial high pressure water blasting machine manufacturer rate pressure is 1000bar,and pressure can be regulate from 0~1000bar,water flow is 50liters per minute,drived by 110kw electric motor,and also have diesel engine drive.the pump use the tech of Germany WOMA.we ...
ZHENGZHOU GUANGYUAN CLEANING EQUIPMENT CO.,LTD [Manufacturing & Processing Machinery] [Other Manufacturing & Processing Machinery] [2017-10-17 16:38:58 ]
rate pressure is 1000bar,and pressure can be regulate from 0~1000bar,water flow is 50liters per minute,drived by 110kw diesel engine,diesel engine we have china weichai brand and cummins brand for your choice, also have electric motor drive.the pump use the tech of Germany ...
ZHENGZHOU GUANGYUAN CLEANING EQUIPMENT CO.,LTD [Manufacturing & Processing Machinery] [Other Manufacturing & Processing Machinery] [2017-10-17 16:37:52 ]
rate pressure is 500bar,pressure can be regulate from 0~500bar,water flow is 23liters per minute,it drives by 30kw diesel engine,diesel engine brand have cummins brand and china weichai brand for your choice.we also have 22kw electric motor drive.The pump used Italy COMET ...
ZHENGZHOU GUANGYUAN CLEANING EQUIPMENT CO.,LTD [Manufacturing & Processing Machinery] [Other Manufacturing & Processing Machinery] [2017-10-17 16:36:28 ]
rate pressure is 1000bar,and pressure can be regulate from 0~1000bar,water flow is 50liters per minute,drived by 110kw electric motor,and also have diesel engine drive.the pump use the tech of Germany WOMA.we configure high pressure hose,high pressure gun,high pressure ...
ZHENGZHOU GUANGYUAN CLEANING EQUIPMENT CO.,LTD [Manufacturing & Processing Machinery] [Other Manufacturing & Processing Machinery] [2017-10-17 16:35:12 ]
Product Description Product ATV LED Flag Light, RGB LED Flagpole with Wireless Remote Voltage 12V Color RGB Size 3ft/4ft/5ft/6ft LED chip 5050LED 60LEDs/meter Waterproof IP65 Certification ISO9001 Advantage Quick release mount Detailed Images Other Products NEW Spiral ATV LED ...
Ningbo Norwayho Auto Parts Co.,Ltd. [Automobiles & Motorcycles] [Exterior Accessories] [2017-10-17 14:05:36 ]
Fote Heavy Machinery Co,.ltd can supply two types of dryer:rotary drying machine and hot airflow type machine/equipment.Rotary type drying equipment shows the features of perfect drying effect, easy operation, high efficiency and easy control of drying.The rotary drying ...
Henan Fote Machinery Co., Ltd. [Manufacturing & Processing Machinery] [Mining Machinery] [2017-10-17 11:32:26 ]
This is Hanjiu Hydraulic from Shijiazhuang Hanjiu Technology Co.,Ltd,we mainly produce Hydraulic orbitrol steering. Our orbitrol steering can widely used for kinds of Agricultural equipments like:Agricultural harvesters,tractors for John Deere,New Holland,Case,Class,JCB etc. ...
Shijiazhuang Hanjiu Technology Co.,Ltd [Tools] [Hydraulic Tools] [2017-10-16 17:26:45 ]
101S series hydraulic steering control unit 1. The same function of the 101 series 2. Including integrated valve (relief valve and checkproof valve) 3. Replace Danfoss (ospc), M+S (HKU/4) series. 4.101S Hydraulic steering unit is widely used in the steering control system such ...
Shijiazhuang Hanjiu Technology Co.,Ltd [Tools] [Hydraulic Tools] [2017-10-16 17:23:50 ]
Multi cavities mold; anti extrusion mold in ensuring the strength of parts at the same time, can shorten the molding cycle, improve production efficiency, our team is experienced in mold design, manufacturing, parts molding.With the advanced equipment and twenty years experience ...
MA.J Plastics Co.,LTD [Electrical Equipment & Supplies] [Switches] [2017-10-16 17:08:38 ]
Assembly workshop adhere to the \"high-quality, efficient, accurate and timely\" for the purpose, Rhythm Production, lean production, visual management, efficient management, provide quality services for customers, accurate production process and punctual delivery. From the ...
MA.J Plastics Co.,LTD [Electrical Equipment & Supplies] [Switches] [2017-10-16 16:51:30 ]
We are dedicated to offering custom peptide synthesis, process development, GMP manufacturing as well as catalog products for customers in industry and research area. Creative Peptides is specialized in the process development and the manufacturing of bioactive peptides. ...
Creative Peptides [Chemicals] [Pharmaceutical Chemicals] [2017-10-16 14:14:40 ]
We are dedicated to offering custom peptide synthesis, process development, GMP manufacturing as well as catalog products for customers in industry and research area. Synonyms/Alias GS peptide-2 CAS No. 851366-97-7 Sequence YRRAAVPPSPSLSRHSSPHQSEDEEE (Modifications: Ser-21 = ...
Creative Peptides [Chemicals] [Pharmaceutical Chemicals] [2017-10-16 14:13:43 ]
Creative Peptides is specialized in the process development and the manufacturing of bioactive peptides. We are dedicated to offering custom peptide synthesis, process development, GMP manufacturing as well as catalog products for customers in industry and research area. We ...
Creative Peptides [Chemicals] [Pharmaceutical Chemicals] [2017-10-16 14:12:46 ]
CAS No. 195262-56-7 Sequence HADGSFSDEMNTILDNLATRDFINWLIQTKITD M.W/Mr. 3796.17 Molecular Formula C166H256N44O56S Application Endogenous peptide identified as an intestinal epithelium-specific growth factor; stimulates cell proliferation and inhibits apoptosis. Diverse effects ...
Creative Peptides [Chemicals] [Pharmaceutical Chemicals] [2017-10-16 14:12:09 ]
Sequence KRMKVAKSAQ M.W/Mr. 1146.42 Molecular Formula C48H91N17O13S Storage -20°C Creative Peptides is specialized in the process development and the manufacturing of bioactive peptides. We are dedicated to offering custom peptide synthesis, process development, GMP ...
Creative Peptides [Chemicals] [Pharmaceutical Chemicals] [2017-10-16 14:10:18 ]