PROTOXIN II

Mg
100
Minimum Order
1
Packaging
N/A
Delivery
7-15 Days
NaV channels and T-type Ca2+ channels, Protx-II inhibits NaV channels1. Protx-II could also modulate T-type Ca2+ channels at higher concentrations2.

SPECIFICATION OF PROTOXIN II
CAT N1030-V
CAS NO. 165168-50-3
Product Name Protoxin II
Purity > 98%
Form/State Lyophilized powder
Solubility Soluble in water
Molecular weight 4054.85 Da
Molecular formula C169H274N54O48S7
Source Synthetic peptide
Storage Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Storage of solutions Up to two weeks at 4°C or three months at -20°C.
Sequence RSCIDTIPKSRCTAFQCKHSMKYRLSFCRKTCGTC (Disulfide bonds: Cys3-Cys35, Cys12-Cys28 and Cys17-Cys32)

APPLICATION OF PROTOXIN II
Protoxin II, an inhibitory cystine knot toxin from the tarantula Thrixopelma pruriens, inhibits voltage-gated sodium channels.

As the best polypeptide company, we provide custom peptide synthesis china, professional peptide, plecanatide tablets, epigenetic histone modification, etc. Contact us to know more.
  • Country: China (Mainland)
  • Business Type: Manufacturer
  • Market:Africa,Americas,Asia
  • Founded Year:2018
  • Address:The 11th floor,New Energy Building,Institute of Advanced Technology,USTC,Hefei, Anhui, China
  • Contact:KS-V Peptide com
*Your name:
*Your Email:
*To:Hefei KS-V Peptide Biological Technology Co., Ltd.
*Subject:
*Message:
Enter between 20 to 3,000 characters. English only.     Characters : 0 / 3000
*Enter the secure code shown below Mfrbee security Image      Reload Image

submiting now We do inquire for you , please wait ...

PROFESSIONAL AMPLIFIER  MX1000II SERIES
PROFESSIONAL AMPLIFIER MX1000II SERIES

The MX Series is the latest design stereo professional amplifier speaker system with low distortion and high efficiency. With reliable protection of overvoltage, under-voltage, DC, short circuit and alarming function conference. BTL connection is available. The professional ...

Guangzhou DSPPA Audio Co., Ltd.

Explosion Proof Led Flood Light Class 1 Div 2 Zone 2 SHF-II Series Advantages
Explosion Proof Led Flood Light Class 1 Div 2 Zone 2 SHF-II Series Advantages

Class I,Div.2,Group A,B,C,D Zone 1, Zone 2 Class II,Div.1,Group E,F,G Zone 21, Zone 22 Class III -40℃ ~ +55℃ Ex eb IIC T6/T5 Gc Type 4X, IP66 Ex tb IIIC T100℃ Db IP66 LED 20W- 180W,120lm/W,3000K-5000K SHF-II series atex floodlight is one of intrinsically safe lighting ...

SUREALL TECHNOLOGY LIMITED

Eye II Series V2.0 Thermal Monocular Xeye E3 max V2
Eye II Series V2.0 Thermal Monocular Xeye E3 max V2

Eye II Series V2.0 Thermal Monocular Xeye E3 max V2 InfiRay, leading manufacturer of uncooled IRFPA InfiRay concentrates on developing infrared thermal imaging technologies and manufacturing relevant products, with completely independent intellectual property rights. InfiRay is ...

IRay Technology Co., Ltd.

retatrutide malanotan II tirzepatide semaglutide
retatrutide malanotan II tirzepatide semaglutide

HGH 10iu 16iu 24iu HCG5000iu CJC1295 TB-500 BPC-157 Tirzepatide semaglutide retatrutide Our company also has many kinds of products please contact me if you need my product whatsapp:+8613681550046 telegram:+8613028607230 ...

Hebei Hailang Biotechnology Co., Ltd

retatrutide malanotan II tirzepatide semaglutide
retatrutide malanotan II tirzepatide semaglutide

HGH HCG5000iu bpc-157 TB-500 Tirzepatide semaglutide retatrutide malanotan II our company also has many kinds of products please contact me if you need my product whatsapp:+8613681550046 telegram:+8613028607230 ...

Hebei Hailang Biotechnology Co., Ltd

Semi-electric Pallet Truck CBD10A-II
Semi-electric Pallet Truck CBD10A-II

Description : We are professional Semi Electric Pallet Truck CBD10A-II supplier and factory in China. We can produce the product according to your requirements. Product Features Two-speed driving system. Emergency brake switch. Manual lifting and motor driving. AC motor,no ...

ATTACK GLOBAL (HONGKONG) CO.,LTD

Protein Induced by Vitamin K Absence or Antagonist-II (PIVKA II Tumor Marker)
Protein Induced by Vitamin K Absence or Antagonist-II (PIVKA II Tumor Marker)

In the absence of vitamin K, liver cells cannot depend on vitamin K in the synthesis of standard clotting factors, only the synthesis of no function of blood coagulation abnormal prothrombin (DCP) -- pivka 2 tumor marker , is the protein induced by vitamin K deficiency or ...

Shenzhen SEKBIO Co., Ltd

Karl Storz Storz Tricam SL II 202230 20 Endoscopy Video Processor
Karl Storz Storz Tricam SL II 202230 20 Endoscopy Video Processor

As one of the endoscopy equipment manufacturers, we provide rhinolaryngoscope, endoscopy video processor, industrial endoscope, etc. Want to know more, contact us.As one of the endoscopy equipment manufacturers, we provide rhinolaryngoscope, endoscopy video processor, industrial ...

HK FY-MED TRADING CO., LIMITED

CAS 121062-08-6   Melanotan II acetate salt
CAS 121062-08-6 Melanotan II acetate salt

14030-76-3 Etazene 14176-50-2 Tiletamine hydrochloride 14680-51-4 Metonitazene 71368-80-4 Bromazolam 109555-87-5 3-(1-Naphthoyl)indole 119276-01-6 Protonitazene (hydrochloride) 2647-50-9 Flubromazepam 2894-61-3 Bromonordiazepam 28981-97-7 Alprazolam 2732926-24-6 N-desethyl ...

Hebei Fangpai New Material Technology

CAS 121062-08-6 Melanotan II acetate salt
CAS 121062-08-6 Melanotan II acetate salt

We have our own factory We can provide good products at reasonable prices. We can send it free of charge, but you have to pay the freight. People who need to study chemicals for medical and laboratory technical purposes look forward to your contact. ...

Hebei Fangpai