APETX2

ASIC3 channels, APETx2 inhibits ASIC3 channels1

SPECIFICATION OF APETX2

CAT O1040-V

CAS NO. 713544-47-9

Product Name APETx2

Purity > 98%

Form/State Lyophilized powder

Solubility Soluble in water

Molecular weight 4561 Da

Molecular formula C196H280N54O61S6

Source Synthetic peptide

Storage Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.

Storage of solutions Up to two weeks at 4°C or three months at -20°C.

Sequence GTACSCGNSKGIYWFYRPSCPTDRGYTGSCRYFLGTCCTPAD(Disulfide bonds between Cys4-Cys37, Cys6-Cys30 and Cys20-Cys38)

APPLICATION OF APETX2

APETx2, a peptide toxin effector of ASIC3, is a 42-amino-acid peptide cross-linked by three disulfide bridges.

As the professional custom peptide company in China, KS-V Peptide has been specialized in providing customized synthesis services of difficult peptides, including Toxins and Analogues, Ubiquitins and Ubiquitin Probes, Post-translational Histones and other peptide manufacturing, APIs and process optimization of the pharmaceutical peptide.

If you want to know more details of Peptide CDMO, please leave us a message.