Product Quick Detail

FOB Price
USD $100.00 / Piece
Minimum Order
1
Place Of Origin
china
Packaging
N/A
Delivery
15 Days

KCa1.1, KV1.2, KV1.3 K+ channels, Charybdotoxin is a potent selective inhibitor of high conductance (maxi-K), different medium and small conductance Ca2+-activated K+ channels, as well as a voltage-dependent K+ channel (KV1.3)1.

SPECIFICATION OF CHARYBDOTOXIN
CAT K1080-V
CAS NO. 95751-30-7
Product Name Charybdotoxin
Purity > 98%
Form/State Lyophilized powder
Solubility Soluble in water
Molecular weight 4296 Da
Molecular formula C176H277N57O55S7
Source Synthetic peptide
Storage Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Storage of solutions Up to two weeks at 4°C or three months at -20°C.
Sequence ZFTNVSCTTSKECWSVCQRLHNTSRGKCMNKKCRCYS(Disulfide bonds between Cys7-Cys28, Cys13-Cys33, and Cys17-Cys35, Z= Pyrrolidone carboxylic acid)

APPLICATION OF CHARYBDOTOXIN
Charybdotoxin (CTX), a peptide from the Leiurus scorpion venom, blocks voltage-gated K(+)-channels

As the custom peptide synthesis companies, we provide professional peptide, peptide library services, peptide toxin, peptide service, peptides synthesis, etc. Contact us to know more.
  • Country: China (Mainland)
  • Business Type: Manufacturer
  • Market:Africa,Americas,Asia
  • Founded Year:2018
  • Address:The 11th floor,New Energy Building,Institute of Advanced Technology,USTC,Hefei, Anhui, China
  • Contact:KS-V Peptide com
*Your name:
*Your Email:
*To:Hefei KS-V Peptide Biological Technology Co., Ltd.
*Subject:
*Message:
Enter between 20 to 3,000 characters. English only.     Characters : 0 / 3000
*Enter the secure code shown below Mfrbee security Image      Reload Image

submiting now We do inquire for you , please wait ...