CHARYBDOTOXIN

KCa1.1, KV1.2, KV1.3 K+ channels, Charybdotoxin is a potent selective inhibitor of high conductance (maxi-K), different medium and small conductance Ca2+-activated K+ channels, as well as a voltage-dependent K+ channel (KV1.3)1.

SPECIFICATION OF CHARYBDOTOXIN

CAT K1080-V

CAS NO. 95751-30-7

Product Name Charybdotoxin

Purity > 98%

Form/State Lyophilized powder

Solubility Soluble in water

Molecular weight 4296 Da

Molecular formula C176H277N57O55S7

Source Synthetic peptide

Storage Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.

Storage of solutions Up to two weeks at 4°C or three months at -20°C.

Sequence ZFTNVSCTTSKECWSVCQRLHNTSRGKCMNKKCRCYS(Disulfide bonds between Cys7-Cys28, Cys13-Cys33, and Cys17-Cys35, Z= Pyrrolidone carboxylic acid)

APPLICATION OF CHARYBDOTOXIN

Charybdotoxin (CTX), a peptide from the Leiurus scorpion venom, blocks voltage-gated K(+)-channels

As the custom peptide synthesis companies, we provide professional peptide, peptide library services, peptide toxin, peptide service, peptides synthesis, etc. Contact us to know more.