SPECIFICATION OF MAMBALGIN 1

Product Quick Detail

FOB Price
USD $100.00 / Piece
Minimum Order
1
Packaging
pe tube
Delivery
15 Days

CAT O1010-V
CAS NO. 1609937-15-6
Product Name Mambalgin 1
Purity > 98%
Form/State Lyophilized powder
Solubility Soluble in water
Molecular weight 6554.5 Da
Molecular formula C272H429N85O84S10
Source Synthetic peptide
Storage Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Storage of solutions Up to two weeks at 4°C or three months at -20°C.
Sequence LKCYQHGKVVTCHRDMKFCYHNTGMPFRNLKLILQGCSSSCSETENNKCCSTDRCNK(Disulfide bonds between Cys4-Cys37, Cys6-Cys30, and Cys20-Cys38)
  • Country: China (Mainland)
  • Business Type: Manufacturer
  • Market: Africa,Americas,Asia
  • Founded Year: 2018
  • Address: The 11th floor,New Energy Building,Institute of Advanced Technology,USTC,Hefei, Anhui, China
  • Contact: KS-V Peptide com

Hefei KS-V Peptide Biological Technology Co., Ltd.

Enter between 20 to 3,000 characters. English only. Characters: 0 / 3000
submiting now We do inquire for you, please wait...