SPECIFICATION OF MAMBALGIN 1

FOB Price
USD $100.00 / Piece
Minimum Order
1
Packaging
pe tube
Delivery
15 Days
CAT O1010-V
CAS NO. 1609937-15-6
Product Name Mambalgin 1
Purity > 98%
Form/State Lyophilized powder
Solubility Soluble in water
Molecular weight 6554.5 Da
Molecular formula C272H429N85O84S10
Source Synthetic peptide
Storage Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Storage of solutions Up to two weeks at 4°C or three months at -20°C.
Sequence LKCYQHGKVVTCHRDMKFCYHNTGMPFRNLKLILQGCSSSCSETENNKCCSTDRCNK(Disulfide bonds between Cys4-Cys37, Cys6-Cys30, and Cys20-Cys38)
  • Country: China (Mainland)
  • Business Type: Manufacturer
  • Market:Africa,Americas,Asia
  • Founded Year:2018
  • Address:The 11th floor,New Energy Building,Institute of Advanced Technology,USTC,Hefei, Anhui, China
  • Contact:KS-V Peptide com
*Your name:
*Your Email:
*To:Hefei KS-V Peptide Biological Technology Co., Ltd.
*Subject:
*Message:
Enter between 20 to 3,000 characters. English only.     Characters : 0 / 3000
*Enter the secure code shown below Mfrbee security Image      Reload Image

submiting now We do inquire for you , please wait ...

Mambalgin 1
Mambalgin 1

Creative Peptides is specialized in the process development and the manufacturing of bioactive peptides. We are dedicated to offering custom peptide synthesis, process development, GMP manufacturing as well as catalog products for customers in industry and research area. Visit ...

Creative Peptides

1.DHSD-0711A  Asphalt Mixture Theoretical Maximum Specific Gravity tester
1.DHSD-0711A Asphalt Mixture Theoretical Maximum Specific Gravity tester

DSHD-0711A Asphalt Mixture Theoretical Maximum Specific Gravity is designed and developed by the stated requirement of the T071 “Theoretical Maximum Specific Gravity and Density of Asphalt Mixture Test (Vacuum Method)” in the Industry Standard of People Republic of China ...