Product Quick Detail

FOB Price
USD $100.00 / Piece
Minimum Order
1
Packaging
pe tube
Delivery
15 Days

SPECIFICATION OF MARGATOXIN

CAT K1020-V
CAS NO. 145808-47-5
Product Name Margatoxin
Purity > 98%
Form/State Lyophilized powder
Solubility Soluble in water
Molecular weight 4179.03 Da
Molecular formula C178H286N52O50S7
Source Synthetic peptide
Storage Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Storage of solutions Up to two weeks at 4°C or three months at -20°C.
Sequence TIINVKCTSPKQCLPPCKAQFGQSAGAKCMNGKCKCYPH (Disulfide bonds between Cys7-Cys29, Cys13-Cys34, and Cys17-Cys36)

APPLICATION OF MARGATOXIN
ShK toxin is a cysteine-rich 35-residue protein ion-channel ligand isolated from the sea anemone Stichodactyla helianthus.

As a peptide company, we can provide professional peptide for sale with reasonable prices, if you are interested, please leave us a message.
  • Country: China (Mainland)
  • Business Type: Manufacturer
  • Market: Africa,Americas,Asia
  • Founded Year: 2018
  • Address: The 11th floor,New Energy Building,Institute of Advanced Technology,USTC,Hefei, Anhui, China
  • Contact: KS-V Peptide com

Hefei KS-V Peptide Biological Technology Co., Ltd.

Enter between 20 to 3,000 characters. English only. Characters: 0 / 3000
submiting now We do inquire for you, please wait...