MARGATOXIN
Product Quick Detail
- FOB Price
- USD $100.00 / Piece
- Minimum Order
- 1
- Packaging
- pe tube
- Delivery
- 15 Days
Specifications
SPECIFICATION OF MARGATOXIN
CAT K1020-V
CAS NO. 145808-47-5
Product Name Margatoxin
Purity > 98%
Form/State Lyophilized powder
Solubility Soluble in water
Molecular weight 4179.03 Da
Molecular formula C178H286N52O50S7
Source Synthetic peptide
Storage Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Storage of solutions Up to two weeks at 4°C or three months at -20°C.
Sequence TIINVKCTSPKQCLPPCKAQFGQSAGAKCMNGKCKCYPH (Disulfide bonds between Cys7-Cys29, Cys13-Cys34, and Cys17-Cys36)
APPLICATION OF MARGATOXIN
ShK toxin is a cysteine-rich 35-residue protein ion-channel ligand isolated from the sea anemone Stichodactyla helianthus.
As a peptide company, we can provide professional peptide for sale with reasonable prices, if you are interested, please leave us a message.
- Country: China (Mainland)
- Business Type: Manufacturer
- Market:Africa,Americas,Asia
- Founded Year:2018
- Address:The 11th floor，New Energy Building，Institute of Advanced Technology，USTC，Hefei, Anhui, China
- Contact:KS-V Peptide com
Other products from Hefei KS-V Peptide Biological Technology Co., Ltd.
Relate products of MARGATOXIN
Margatoxin
Creative Peptides is specialized in the process development and the manufacturing of bioactive peptides. We are dedicated to offering custom peptide synthesis, process development, GMP manufacturing as well as catalog products for customers in industry and research area. Visit ...
