Product Quick Detail

Minimum Order
1
Packaging
N/A
Delivery
15 Days

Various KV K+ channels. Stichodactyla Toxin blocks KV1.3, KV1.1, KV1.4, and KV1.6 at subnanomolar concentrations and KV3.2 channels at 1000-fold higher concentration than that required to inhibit KV1.3 channels.

SPECIFICATION OF SHK TOXIN
CAT K1010-V
CAS NO. 172450-46-3
Product Name ShK Toxin
Purity > 98%
Form/State Lyophilized powder
Solubility Soluble in water
Molecular weight 4055 Da
Molecular formula C169H274N54O48S7
Source Synthetic peptide
Storage Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Storage of solutions Up to two weeks at 4°C or three months at -20°C.
Sequence RSCIDTIPKSRCTAFQCKHSMKYRLSFCRKTCGTC (Disulfide bonds between Cys3-Cys35, Cys12-Cys28, and Cys17-Cys32)

APPLICATION OF SHK TOXIN
ShK toxin is a cysteine-rich 35-residue protein ion-channel ligand isolated from the sea anemone Stichodactyla helianthus.

Hefei KS-V Peptide is a pre-clinical new drug research and development CRO company based on structure and chemistry and it has grown into one of the leading and full-fledged peptide manufacturers and custom peptide library suppliers in China. With peptides as the core, it provides innovative peptide and protein products and services for global pharmaceutical companies, biological technology companies, and scientific research institute.
  • Country: China (Mainland)
  • Business Type: Manufacturer
  • Market: Africa,Americas,Asia
  • Founded Year: 2018
  • Address: The 11th floor,New Energy Building,Institute of Advanced Technology,USTC,Hefei, Anhui, China
  • Contact: KS-V Peptide com

Hefei KS-V Peptide Biological Technology Co., Ltd.

Enter between 20 to 3,000 characters. English only. Characters: 0 / 3000
submiting now We do inquire for you, please wait...